KEGG   Canis lupus familiaris (dog): 100855915
Entry
100855915         CDS       T01007                                 

Gene name
ATP13A4
Definition
(RefSeq) probable cation-transporting ATPase 13A4 isoform X1
  KO
K14951  cation-transporting P-type ATPase 13A3/4/5 [EC:7.2.2.-]
Organism
cfa  Canis lupus familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100855915 (ATP13A4)
SSDB
Motif
Pfam: E1-E2_ATPase P5-ATPase Hydrolase Cation_ATPase_N Cation_ATPase DUF2620
Other DBs
NCBI-GeneID: 100855915
NCBI-ProteinID: XP_005639905
Ensembl: ENSCAFG00000014158
VGNC: 38244
UniProt: F1PRT7
Position
34
AA seq 1197 aa
MGDQFEKGQHALLNEGEENEMEIFGYRTQGCRKTLCLAGSIFSFGILPLVFYWRPAWHVW
ANCVPCSLQEADVVLLKTTDEFQTYSWKKIMWIYLSSLNGASGVTPDHPLITDEEYVINR
AIRKPDLKVRCIKVQKIRYVWNNLEGQFQKIGCLEDWLSSAKIHLKFGSGLTKEEQEIRR
LICGPNTIDVEITPIWKLLIKEVLNPFYIFQLFSVCLWFSEDYKEYAFAIIIMSIMSIAL
TVYDLREQSIKLHRLVESHNSITVSVFVRKAGVQELESRFLVPGDLLVLTGNKVQMPCDA
ILIDGSCVVDEGMLTGESIPVTKTPLPKLESSEPWKTQSEADYKRHVLFCGTEVIQAKGG
CSGTVRAVVLQTGFNTAKGDLVRSILYPKPMNFKLYRDAIRFLLCLVGTATIGMIYTLCV
YVLSGEPPEEIVKKALDVITIAVPPALPAALTTGIIYAQRRLKKRGIFCISPQRINVCGQ
LNLVCFDKTGTLTRDGLDLWGVLPCDRSGFQEVHSFASGTSLPWGPLCAAMASCHSLILL
DGTIQGDPLDLKMFEATTWEMAISEDGFHIKGVPAHAMVVKPCETASQVPVEGIAILHQF
PFSSALQRMTVIAQEIGGDRLAFMKGAPERVASFCQPETVPTSFASELQIYTTQGFRVIA
LAYKKLEMDHHTTSLTRDKVESDLIFLGLLILENRLKDETKPVLEELISARIRTVMVTGD
NLQTAITVARKSGMVSESQKVILIEANETTGSSSASISWKLVENKKHISYSNQDNYINIR
EEVSDNGKEGSYHFALSGKSFQVISQHFSSLLPKILINGTIFARMSPGQKSSLVEEFQKL
DYFVGMCGDGANDCGALKMAHVGISLSEQEASVASPFTSKTPNIECVPHLIKEGRAALVT
SFCMFKYMALYSMIQYVGVLLLYWETNSLSNYQFLFQDLAITTLIGITMNLNDAYPKLVP
FRPAGRLISPPLLLSVIFNILLSLAMHIVGFILVQRQPWYSMEMHSACILQNESISKLTI
SPTAPGKIGNNGAFTSYENTTIWFLGTINCIIVALIFSKGKPFRQPIYTNYIFVLVLVIQ
LSVCLFILFADIPELYRRLDLLCTPVVWRLYIIIMLSSNFIVSLVVEEAIIENRALWMSF
KRCFGYQSKSQYRILQRTLANDPSWPLLNQMSYSDTPGCESGVSYSNPVFESNEEQL
NT seq 3594 nt   +upstreamnt  +downstreamnt
atgggggaccagtttgagaagggccagcatgctctgctcaatgaaggagaagagaatgag
atggagatatttggctaccggactcaaggctgccggaaaactctctgtcttgctggatcc
atcttctcctttgggatcctccctttggtgttttactggagacccgcttggcacgtgtgg
gcaaattgtgtgccgtgttccttgcaagaggcagacgtcgtgttgctgaagacaacagat
gaattccaaacttactcatggaaaaagataatgtggatctacctgtcatcattaaacggc
gcatctggtgtcactcctgaccaccctctcattacagatgaggagtacgtcataaataga
gccatcagaaagccagacctaaaggtgagatgcataaaagtgcagaaaataagatatgtt
tggaacaacttagaaggacagttccaaaaaattggctgtttggaagactggctcagttct
gccaagatacacctaaaatttggatcaggtctaacaaaagaagaacaagagattaggagg
ctaatatgtgggcctaacactattgatgttgaaatcacaccaatttggaaactactcatc
aaggaggttttaaatccgttttacatatttcaactcttcagtgtctgtttgtggtttagt
gaagactataaggaatatgcttttgccatcataatcatgtctatcatgtccatagctttg
acggtgtatgatctcagagagcaatctataaaactccaccgtctagttgagtcacataat
agcattacagtctctgtatttgtgagaaaagcaggagtccaagagctggaatcacgtttc
ctggtacctggagatttattagttttgacggggaacaaagtacaaatgccatgcgatgcc
atcctgattgacggcagctgtgtggtagatgaaggcatgctgacaggagaaagtattcca
gtgactaaaactccattacccaaactggagagctctgagccctggaaaacacagagtgaa
gcagactataaacgacatgtcctcttctgtgggacagaggttatccaagccaagggaggg
tgctctgggaccgtgagagcagtggtgctgcagactggattcaacactgcaaaaggggac
ctcgtgagatccattctctacccaaagccaatgaattttaagctctacagggatgccatc
aggttcctcctgtgccttgtggggacagcaaccattgggatgatctatactttgtgcgtc
tatgtgctcagcggggaacctcccgaggagatagtgaagaaagccctcgatgtcatcaca
attgcagttcctcctgccctgcctgctgctctgactacgggcattatctatgcccagagg
aggctgaagaagagaggcatcttttgcatcagtccccagaggatcaatgtatgtggacag
ttaaaccttgtctgctttgacaagacaggcaccttaacaagggatggtttggatctctgg
ggagtcctgccctgcgataggagcggctttcaggaagtccacagctttgcctcagggacg
tctttgccgtggggccctctgtgtgcggccatggccagctgccactctctgatccttctt
gatgggaccatccagggagatcctctggatctcaagatgtttgaagccaccacctgggag
atggctatttctgaggacggtttccacatcaagggagtgccagcacatgccatggtagtt
aagccctgcgaaacagccagccaggtcccggtggaaggaattgcaatcctgcatcagttc
ccattctcatcagcactgcagaggatgacagtcattgcccaagagatagggggtgaccgg
ctggcattcatgaaaggtgcaccagaaagggtggccagcttttgccaacctgagacagta
ccaactagttttgctagcgaacttcagatttacacaacacagggcttccgagtcatagca
ctggcatataagaagctggaaatggatcatcacaccacctccttgacaagggacaaagta
gaatcagatctgatatttctgggattgctaatcttggagaatcggttgaaggacgagaca
aaacctgttctggaagagctcatctcagcccggataaggactgtaatggtcacaggtgac
aatcttcaaactgcaataacagtggctagaaagtctggaatggtttctgaaagccaaaaa
gtcattctcattgaagcgaatgaaaccactggatcctcatcagcatctatatcttggaaa
ttagtagaaaataagaaacacatttcatacagcaatcaggataattacattaatatcagg
gaagaagtctctgataatggcaaagaaggaagttaccactttgccttaagtggaaaatcc
tttcaggttataagtcaacatttcagcagcctactgccaaagatactgatcaatgggacc
atctttgcaagaatgtctcctgggcagaaatccagtctggtggaagaatttcagaaactg
gattacttcgtaggtatgtgcggtgatggggccaatgactgtggggctttgaaaatggct
cacgtgggcatctcgttatcagagcaggaggcatctgtggcctcaccgttcacttcaaaa
actccaaacattgagtgtgtacctcaccttatcaaggaaggacgcgcagctctcgtcacc
tcattctgcatgtttaagtacatggctctgtacagcatgattcagtatgttggtgttctg
ctgctctactgggagacaaacagcctttcaaattaccagtttctgttccaggatctggcc
atcacaactcttattggcataacaatgaatttgaatgatgcctaccccaagctggtgcct
ttcaggcctgcaggacggctgatctctccacctctgctgctttctgtgattttcaacatt
cttctcagcctggctatgcacattgtgggcttcattctggttcagaggcagccttggtat
tccatggagatgcacagtgcctgcatactgcaaaatgaaagtatctcaaagttaactatt
tctccaactgctccaggaaaaattggaaataatggtgccttcacaagctatgagaacact
accatatggttcttgggaacaatcaactgtatcattgtggctcttattttctctaaagga
aaaccatttaggcagcccatctatacaaactatatatttgtccttgtgctggtcatacag
ctgagtgtgtgtctattcattctatttgctgatattccagaattatataggcgtttggat
ctgctctgcactcctgttgtgtggaggctctacatcatcattatgctcagctccaatttc
attgtgtcccttgttgtggaggaggccatcattgaaaaccgagccctgtggatgtcattc
aaaaggtgtttcggttatcaatcaaaaagccaatatcggatattgcagaggaccttggca
aatgaccctagttggccgctgctaaaccaaatgtcctactctgacacgccagggtgtgaa
agtggagtgtcttacagcaatccagtatttgagagcaatgaggaacaactctga

DBGET integrated database retrieval system