KEGG   Canis familiaris (dog): 100855976Help
Entry
100855976         CDS       T01007                                 

Gene name
ADRA2B
Definition
(RefSeq) alpha-2B adrenergic receptor
  KO
K04139  adrenergic receptor alpha-2B
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04022  cGMP-PKG signaling pathway
cfa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    100855976 (ADRA2B)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100855976 (ADRA2B)
G protein-coupled receptors [BR:cfa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    100855976 (ADRA2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 100855976
NCBI-ProteinID: XP_005642499
Ensembl: ENSCAFG00000006805
VGNC: 37675
UniProt: F1Q1Q4
Position
17
AA seq 444 aa AA seqDB search
MDHQEPYSVQATAAIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADIL
VATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEY
NSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGS
FFAPCLIMILVYLRIYLIAKRSHRRGPRAAGGRGEGESKQPHSVPTAASTKLPTLASLAA
SGEANGHSKPTGEKEEGDTSEDPGTPALPPSWSAVPNPGQSQKEGVCGASPEEEAEMEEG
EEECEPQALPASPAAACSPPLRQPQGSRVLATLRGQVLLGRGVGTTSGQWWRRRAQLTRE
KRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPQHCKVPHGLFQFFFWIGYCNSSLNPVIY
TIFNQDFRRAFRRILCRQWTQTAW
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggaccaccaggagccctactcggtgcaggccaccgcggccatcgcggcggtcatcacg
ttcctcatcctcttcaccatcttcggcaacgcgctggtcatcctggccgtgttgacgagc
cgctcgctgcgcgccccgcagaacctgttcctggtgtcgctggccgcagccgacatcctg
gtggccacgctcatcatccccttctcgctggccaacgagctgctgggctactggtacttc
cggcgcacgtggtgcgaggtgtacttggcgctcgacgtgctcttctgcacctcgtccatc
gtgcacctgtgcgccatcagcctggaccgctactgggccgtgagtcgcgcgctcgagtac
aactccaagcgcaccccgcgccgcatcaagtgcatcatcctcaccgtgtggctcatcgca
gcggtcatctccctgccgccgcttatctacaagggcgaccaggggccccagccccgcggg
cgcccacagtgcaaactcaaccaagaagcctggtacatcctggcctctagcatcggctcc
ttctttgcaccctgcctcatcatgatccttgtctacctgcgcatctacttgatcgccaaa
cgcagtcaccgcagaggtcccagggccgcggggggccgcggggagggtgagtccaagcag
ccgcactcggtccccacggcagcttcaaccaaactgccaaccctggcctctctggctgct
tctggagaggccaatggacactcgaagcctactggggagaaggaagagggcgatacctct
gaagatccggggacccctgccttgccacccagctggtcagccgttcccaacccaggccag
agtcagaaggaaggcgtgtgtggggcatctccagaggaggaagccgagatggaggaaggg
gaggaagagtgtgagcctcaggccttaccggcgtctcctgcggcagcttgtagcccaccc
ctgcggcagccacagggttctcgggtgctggcaactctacgtggccaggtgctcctgggc
aggggtgtgggcaccacgagcgggcagtggtggcgtcggcgggcacagctgaccagggag
aagcggttcacctttgtgctggccgtggtcattggtgtttttgtgctctgctggttccct
ttcttcttcagctacagcctgggtgccatctgcccacagcactgcaaggtgccccatggt
ctcttccagttcttcttctggattggctactgtaacagctcgctgaaccctgtcatctat
accatctttaaccaggactttcgccgtgccttccgaaggatcctctgccgccagtggacc
cagacggcatggtga

DBGET integrated database retrieval system