KEGG   Canis familiaris (dog): 100856079Help
Entry
100856079         CDS       T01007                                 

Gene name
CDK1
Definition
(RefSeq) cyclin-dependent kinase 1
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04110  Cell cycle
cfa04114  Oocyte meiosis
cfa04115  p53 signaling pathway
cfa04218  Cellular senescence
cfa04540  Gap junction
cfa04914  Progesterone-mediated oocyte maturation
cfa05170  Human immunodeficiency virus 1 infection
cfa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100856079 (CDK1)
   04114 Oocyte meiosis
    100856079 (CDK1)
   04115 p53 signaling pathway
    100856079 (CDK1)
   04218 Cellular senescence
    100856079 (CDK1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100856079 (CDK1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100856079 (CDK1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100856079 (CDK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100856079 (CDK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfa01001]
    100856079 (CDK1)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cfa03032]
    100856079 (CDK1)
   03036 Chromosome and associated proteins [BR:cfa03036]
    100856079 (CDK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    100856079 (CDK1)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100856079 (CDK1)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     100856079 (CDK1)
Protein kinases [BR:cfa01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100856079 (CDK1)
DNA replication proteins [BR:cfa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    100856079 (CDK1)
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100856079 (CDK1)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100856079 (CDK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like APH Kdo Seadorna_VP7 Choline_kinase
Motif
Other DBs
NCBI-GeneID: 100856079
NCBI-ProteinID: XP_003639061
Ensembl: ENSCAFG00000012904
VGNC: 39042
UniProt: E2RGJ9
Position
4
AA seq 297 aa AA seqDB search
MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQFMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLVYDPAKRISGKMALNHPYFNDLDNQIKKM
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggaagattataccaaaatagagaaaattggagaaggtacctatggagttgtgtataag
ggtagacacaaaactacaggtcaagtggtagccatgaagaaaatcagactagaaagtgaa
gaggaaggggttcctagtactgcaattcgggaaatttctctattaaaagaacttcgtcat
ccaaatatagtcagtcttcaggatgtgcttatgcaagattccaggttatatctcatcttt
gaattcctttccatggatctcaagaaatacttagattccatccctcctggtcagttcatg
gattcttcacttgttaagagttatttgtaccaaatcctacaagggattgtgttttgccac
tccagaagagttctgcacagagacttaaaacctcaaaatctattgattgatgacaaaggg
acaattaaattggctgattttggccttgccagagcttttggaatacctattagagtatac
acacatgaggtagtaacactgtggtatagatctccagaagtattgttggggtcagctcgc
tactcaactccagttgacatttggagtataggtaccatatttgcagagttagcaactaag
aaaccacttttccatggggattcagaaatcgatcaactcttcagaattttcagagctttg
ggcacccccaataatgaagtgtggccagaagtggaatctttacaggactataagaataca
tttcccaagtggaaaccaggaagcctggcatcccatgttaaaaacttggatgaaaatggc
ttggatctgctctcaaaaatgttagtctatgatcctgccaaacgaatttctggcaaaatg
gcattgaatcatccatattttaatgatttggacaatcagattaagaagatgtag

DBGET integrated database retrieval system