KEGG   Canis familiaris (dog): 100856186Help
Entry
100856186         CDS       T01007                                 

Definition
(RefSeq) histone H2B type 1
  KO
K11252  histone H2B
Organism
cfa  Canis familiaris (dog)
Pathway
cfa05034  Alcoholism
cfa05203  Viral carcinogenesis
cfa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100856186
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100856186
  09165 Substance dependence
   05034 Alcoholism
    100856186
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfa03036]
    100856186
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    100856186
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    100856186
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100856186
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 100856186
NCBI-ProteinID: XP_003640209
Ensembl: ENSCAFG00000031494
UniProt: H9GWB1
Position
35
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagcccgccaagtccgcgccggccccgaagaagggctccaagaaggcggtgacc
aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg
tacgtgtacaaggtgctgaagcaggtgcaccccgacacgggcatctcgtccaaggccatg
ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ctggcgcattacaacaagcgctcgaccatcacgtccagggagatccagacggccgtgcgc
ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggctgtcacc
aagtacaccagctccaagtaa

DBGET integrated database retrieval system