KEGG   Canis lupus familiaris (dog): 100856347
Entry
100856347         CDS       T01007                                 

Gene name
PYCARD
Definition
(RefSeq) apoptosis-associated speck-like protein containing a CARD isoform X1
  KO
K12799  apoptosis-associated speck-like protein containing a CARD
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04217  Necroptosis
cfa04621  NOD-like receptor signaling pathway
cfa04623  Cytosolic DNA-sensing pathway
cfa04625  C-type lectin receptor signaling pathway
cfa05132  Salmonella infection
cfa05133  Pertussis
cfa05134  Legionellosis
cfa05135  Yersinia infection
cfa05164  Influenza A
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100856347 (PYCARD)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100856347 (PYCARD)
   04623 Cytosolic DNA-sensing pathway
    100856347 (PYCARD)
   04625 C-type lectin receptor signaling pathway
    100856347 (PYCARD)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100856347 (PYCARD)
   05135 Yersinia infection
    100856347 (PYCARD)
   05133 Pertussis
    100856347 (PYCARD)
   05134 Legionellosis
    100856347 (PYCARD)
  09172 Infectious disease: viral
   05164 Influenza A
    100856347 (PYCARD)
SSDB
Motif
Pfam: CARD PYRIN CARD_2 DUF327
Other DBs
NCBI-GeneID: 100856347
NCBI-ProteinID: XP_013969836
UniProt: E2RQ18
Position
6
AA seq 195 aa
MGRIRDAILDALENLTAEEFKKFKMKLLSVPLREGYGRIPRGTLLPMDAMDLTDKLVSFY
LEEYGAELTAVVLRDIGMQETAERLQETSHKGHTPGPAGIQDYQTAAKPGASHFVDQHRA
ALITRVTEVDEVLDALYGKVLSEQQYQAVRAESTNPGKMRKLFSFAPAWNTTCKDLLLTA
LRNTQPYLVADLEKS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggggcgcattcgcgacgccatcctggatgcactggagaacctaactgcagaggagttc
aagaaattcaagatgaagctactttcagtgcccctgcgtgaaggctacgggcgcatccct
cgggggacgctgctgcctatggacgccatggatctcacagacaagctcgtctctttctat
ctggaagagtacggtgcagagctcactgcggtcgtgctgcgggacattggcatgcaggag
acagcagagcggctgcaggagacctcacacaaaggccacactccagggcctgctgggatc
caggattaccagacagcagccaagccaggagcatcacactttgtggaccagcaccgggcc
gccctcatcacacgtgtcacagaggtggatgaggtgctggatgccctgtatgggaaagtc
ctgtcagagcagcagtaccaggcagtgcgggcagagtctaccaatccagggaaaatgagg
aagctcttcagctttgctccagcctggaacaccacctgcaaagatcttctccttacggcc
ctgaggaacacccagccctacctggtggccgacctggagaaaagctga

DBGET integrated database retrieval system