KEGG   Canis familiaris (dog): 100856477Help
Entry
100856477         CDS       T01007                                 

Gene name
FGFR1
Definition
(RefSeq) fibroblast growth factor receptor 1 isoform X1
  KO
K04362  fibroblast growth factor receptor 1 [EC:2.7.10.1]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04010  MAPK signaling pathway
cfa04014  Ras signaling pathway
cfa04015  Rap1 signaling pathway
cfa04151  PI3K-Akt signaling pathway
cfa04520  Adherens junction
cfa04550  Signaling pathways regulating pluripotency of stem cells
cfa04714  Thermogenesis
cfa04810  Regulation of actin cytoskeleton
cfa04928  Parathyroid hormone synthesis, secretion and action
cfa05200  Pathways in cancer
cfa05205  Proteoglycans in cancer
cfa05215  Prostate cancer
cfa05218  Melanoma
cfa05224  Breast cancer
cfa05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100856477 (FGFR1)
   04015 Rap1 signaling pathway
    100856477 (FGFR1)
   04010 MAPK signaling pathway
    100856477 (FGFR1)
   04151 PI3K-Akt signaling pathway
    100856477 (FGFR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100856477 (FGFR1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100856477 (FGFR1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100856477 (FGFR1)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100856477 (FGFR1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100856477 (FGFR1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    100856477 (FGFR1)
   05230 Central carbon metabolism in cancer
    100856477 (FGFR1)
   05205 Proteoglycans in cancer
    100856477 (FGFR1)
  09162 Cancers: Specific types
   05218 Melanoma
    100856477 (FGFR1)
   05215 Prostate cancer
    100856477 (FGFR1)
   05224 Breast cancer
    100856477 (FGFR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfa01001]
    100856477 (FGFR1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cfa04090]
    100856477 (FGFR1)
   00536 Glycosaminoglycan binding proteins [BR:cfa00536]
    100856477 (FGFR1)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100856477 (FGFR1)
Protein kinases [BR:cfa01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   100856477 (FGFR1)
CD molecules [BR:cfa04090]
 Proteins
  100856477 (FGFR1)
Glycosaminoglycan binding proteins [BR:cfa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   100856477 (FGFR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase I-set Ig_3 ig Ig_2 V-set FGFR3_TM Ig_5 C2-set_2 Ig_6 Ig_4 Pkinase_fungal Kinase-like DUF1615 DUF4611
Motif
Other DBs
NCBI-GeneID: 100856477
NCBI-ProteinID: XP_005629905
Ensembl: ENSCAFG00000005970
VGNC: 40856
UniProt: E2R186
Position
16
AA seq 822 aa AA seqDB search
MWSWKCLLFWAVLVTATLCTARPAPTLPEQAQSWGAPVEVESFLVHPGDLLQLRCRLRDD
VQSINWLRDGVQLVESNRTRITGEEVEVRDSVPADSGLYACVTSSPSGSDTTYFSVNVSD
ALPSSEDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPS
SGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSIN
HTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKI
GPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLE
ALEERPAAMTSPLYLEIIIYCTGAFLISCMVGSVIIYKMKSGTKKSDFHSQMAVHKLAKS
IPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVL
GKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGK
HKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDL
VSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNG
RLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMD
KPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSVPLDQYSPSF
PDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgtggagctggaagtgcctcctcttctgggctgtgctggtcacagccacactgtgcact
gccaggccggccccgaccttgcctgaacaagcccagtcctggggagcccctgtggaagtg
gagtccttcctggtccaccctggtgacctgctgcagcttcgctgtcggctgcgggacgat
gtgcagagcatcaactggctgcgggacggggtgcagctggtggagagcaaccgtacccgc
atcacgggggaggaggtggaggtgcgggattccgtgcctgctgactccggcctctacgct
tgtgtgaccagcagtccctcgggcagtgacaccacctacttctccgtcaatgtctcagat
gctctcccctcctcagaggacgacgatgatgatgatgactcctcttcagaggagaaagag
acagataacaccaaaccaaaccgtatgcccgtggctccgtactggacatccccagaaaag
atggaaaagaaattgcacgcggtgccggctgccaagaccgtgaagttcaaatgcccttcc
agtgggactcccaaccccacgctgcgctggttgaaaaatggcaaagaattcaaacctgac
cacaggattggaggctataaggtccgttacgccacctggagcatcataatggactccgtg
gtgccttctgataagggcaactacacctgcattgtggagaacgaatatggcagcattaac
cacacctaccagctcgatgtcgtggagcggtcccctcaccggcccatcctgcaggcgggg
ctgcctgccaacaagacagtggccctgggcagcaatgtggagttcatgtgtaaggtgtac
agtgacccacagccgcatatccagtggctcaagcacatcgaggtgaatgggagtaagatt
ggtcccgacaacctgccttatgtccagatcttgaagactgccggagttaataccaccgac
aaagagatggaagtgcttcacttaaggaatgtctcctttgaggacgcgggggagtatacg
tgcttggcgggtaactctatcggactctcccatcactctgcatggttgaccgttttggaa
gccctggaagagaggccagcagcgatgacctcgcccctatacctggagatcatcatctac
tgcacaggggccttcctcatctcctgcatggtgggctctgtcatcatctacaagatgaag
agtggcaccaaaaagagcgacttccacagccaaatggctgtgcacaagctggccaagagc
atccctctgcgcagacaggtaacagtgtcggccgattctagtgcatccatgaactctggg
gttctgctggttcggccctcacgtctctcctcaagtggaacacccatgctggctggggtc
tctgaatatgagcttcccgaagaccctcgctgggaactgcctcgagacaggctggtttta
ggcaaacccctgggagagggctgctttgggcaggtggtattggcagaagccattgggctg
gacaaggacaaacccaaccgtgtgaccaaagtggccgtgaagatgttgaagtcggatgct
acagagaaagacctgtcagacctgatctcagaaatggagatgatgaagatgatcggaaag
cacaagaacatcatcaacctgctgggggcgtgcacgcaggacggtcccttgtatgtcatc
gtggagtatgcttccaaaggcaacttacgggagtacctgcaggcccggaggcctcctggg
ctggagtactgttacaatcccagccacaacccagaggagcagctctcctccaaggacctg
gtatcctgcgcctatcaggtggcccgaggcatggaatatctcgcctcaaagaagtgcata
caccgagacctggctgccaggaatgtgctggtgacggaggacaacgtgatgaagatcgca
gactttggccttgcaagggacattcaccacatcgactactataaaaagacaaccaacggc
cggctgcctgtgaagtggatggcacctgaggccttgtttgaccggatctacacccaccag
agtgacgtctggtcttttggggtgctcctttgggaaatcttcactctgggaggctccccg
tatcctggtgtgcctgtggaggagcttttcaagctgctgaaggagggtcatcgaatggac
aagcccagtaactgcaccaatgaactgtacatgatgatgcgggattgctggcatgcagtg
ccctctcagagacctaccttcaagcagctggtggaagacctggatcgcatcgtggccttg
acctccaaccaggagtacctggacctgtcagtgcccctggaccaatactctccaagcttc
cctgacacccgaagctccacctgctcctcgggggaggattccgtcttctctcatgagccg
ttgcctgaggagccgtgtctgccccgacacccagcccagcttgccaatggcggactcaaa
cgacgctga

DBGET integrated database retrieval system