KEGG   Canis lupus familiaris (dog): 100856588
Entry
100856588         CDS       T01007                                 

Gene name
PRDX4
Definition
(RefSeq) peroxiredoxin-4 isoform X6
  KO
K03386  peroxiredoxin 2/4 [EC:1.11.1.24]
Organism
cfa  Canis lupus familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    100856588 (PRDX4)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.24  thioredoxin-dependent peroxiredoxin
     100856588 (PRDX4)
Exosome [BR:cfa04147]
 Exosomal proteins
  Proteins found in most exosomes
   100856588 (PRDX4)
SSDB
Motif
Pfam: AhpC-TSA Redoxin 1-cysPrx_C
Other DBs
NCBI-GeneID: 100856588
NCBI-ProteinID: XP_003640290
Ensembl: ENSCAFG00000013369
VGNC: 44952
UniProt: A0A5F4DI88
Position
X
AA seq 257 aa
MDHRSRPRGIGLNRIPGTRTCRTPLPFHVEQQEAREGEEFEQREVPRQRTPVYVPPESEE
LTDNVMVSKPAPYWEGTAVINGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDR
IEEFKSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIKIPLLSDLTHQISKDYGVYLED
SGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDRHGEVCPAGWKPGSE
TIIPDPAGKLKYFDKLN
NT seq 774 nt   +upstreamnt  +downstreamnt
atggatcaccgaagccgacctcggggcataggcctgaaccgaatccccgggactcgaacc
tgtcgaaccccactccccttccatgtggaacaacaggaagcccgggaaggagaagaattc
gaacaacgggaagtacctcgtcagagaactcctgtctacgtgcccccggaaagtgaagag
ctgacagacaatgttatggtttccaagccagcgccttattgggaaggaacagctgtgata
aatggagaattcaaggagctcaagttgactgattatcgtgggaaatacctggtttttttc
ttctacccccttgatttcacctttgtgtgtccaactgaaatcatcgcctttggtgataga
attgaagaattcaaatcgataaacactgaagtggtagcatgctctgttgattcacagttt
acccatttggcctggattaatacccctcgacgacaaggaggacttgggccaataaagatt
ccacttctttcggatctgacccatcaaatctcaaaggactatggcgtatatctggaggac
tcaggccatactcttagaggtcttttcattattgatgacaaaggaatcctaagacagatt
actctgaatgacctcccagttggtagatcagtggatgaaacactgcgtttggttcaagca
ttccagtatactgaccgacatggagaagtctgccctgctggttggaaacctggtagcgaa
actataatcccagatccagctggaaaactgaagtattttgacaaactcaactga

DBGET integrated database retrieval system