KEGG   Canis familiaris (dog): 100856712Help
Entry
100856712         CDS       T01007                                 

Gene name
GTF2H4
Definition
(RefSeq) general transcription factor IIH subunit 4 isoform X1
  KO
K03144  transcription initiation factor TFIIH subunit 4
Organism
cfa  Canis familiaris (dog)
Pathway
cfa03022  Basal transcription factors
cfa03420  Nucleotide excision repair
cfa05203  Viral carcinogenesis
Module
cfa_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    100856712 (GTF2H4)
  Replication and repair
   03420 Nucleotide excision repair
    100856712 (GTF2H4)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100856712 (GTF2H4)
Transcription machinery [BR:cfa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100856712 (GTF2H4)
DNA repair and recombination proteins [BR:cfa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     100856712 (GTF2H4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tfb2 Helicase_C_3
Motif
Other DBs
NCBI-GeneID: 100856712
NCBI-ProteinID: XP_003639474
Ensembl: ENSCAFG00000032081
VGNC: 41548
UniProt: F1PGI3
Position
12
AA seq 463 aa AA seqDB search
MESTPARGGLNRVHLQCRNLQEFLGGLSPGVLDRLYGHPATCLAVFRELPFLAKNWVMRM
LFLEQPLPQAAVALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLR
IALLGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVVLHFMVGSPSAAVSQDLAQLL
SQAGLMKSTEPGEPPCITSAGFQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQ
LSFSTLGKDYSVEGMSDSLLNFLQHLREFGLVFQRKRKSRRYYPTRLAINLSSGVSGAGG
TAHQPGFIIVETNYRLYAYTESELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGI
TAQQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFE
LLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggagagcacccccgcaaggggaggactgaaccgagtacacctacaatgcaggaatctg
caggaattcctagggggcctgagccctggcgtcttggaccgattgtatgggcatcctgcc
acctgtctggctgtcttcagggagctcccatttttggctaagaactgggtgatgcggatg
ctctttctggagcagcctttgccacaagctgctgtagccctgtgggtgaagaaggaattc
agcaaagctcaggaggaaagtacaggactgctgagtggtctccgtatctggcacacccag
ctgctccctggtggtctccagggcctcatcctcaaccccatcttccgccagaacctccgc
attgcccttctgggtgggggcaaggcctggtctgatgacacaagtcagctgggtccagac
aagcacgcccgggatgttccctcacttgacaagtacgccgaggagcgatgggaggtggtc
ctgcacttcatggtgggctcccccagtgcagccgtcagccaggacttggctcagctcctc
agccaggctgggctcatgaagagcactgaacccggagagccaccctgcattacttcagcc
ggcttccagttcctgttgctggacactcctgcccagctatggtactttatgttgcaatat
ctgcagacagcccagagtcggggcatggacctagtggagattctatccttcctcttccag
ctcagcttctctactctgggcaaggattactctgtggaaggtatgagtgattcgttgttg
aatttcctgcaacatctgcgtgagtttgggcttgttttccagaggaagaggaaatctcgg
cgttactaccccacacgcctggctatcaatctctcatcaggtgtttctggagctgggggt
actgcccatcagccaggcttcattatcgtggaaactaattaccgactatatgcctacact
gagtcggagttgcagatcgccctcattgccctcttctcagagatgctctatcgcttcccc
aatatggtggtggcacaggtgacccgggagagcgtgcagcaggccatcgccagtggcatc
acagcccagcagatcatccatttcctaaggacaagggcccacccggtgatgctcaaacag
acgcctgtgctgccacccaccatcacagaccagattcggctatgggagctggaaagggac
agactccggttcactgagggtgtcctgtataaccagttcctgtcgcaagtggactttgag
ctgctgctggcccatgctcgggagctgggtgtgctggtgttcgagaactcggccaagcgg
ctgatggtggtgaccccggctggtcacagcgacgtcaagcgcttctggaagcggcagaag
cacagctcctga

DBGET integrated database retrieval system