KEGG   Canis familiaris (dog): 100856724Help
Entry
100856724         CDS       T01007                                 

Gene name
NMNAT1
Definition
(RefSeq) nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00760  Nicotinate and nicotinamide metabolism
cfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    100856724 (NMNAT1)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     100856724 (NMNAT1)
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     100856724 (NMNAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like CCDC71L
Motif
Other DBs
NCBI-GeneID: 100856724
NCBI-ProteinID: XP_003639109
Ensembl: ENSCAFG00000032251
VGNC: 43862
UniProt: J9P111
Position
5
AA seq 279 aa AA seqDB search
MENSKMEVVLLACGSFNPITNMHLRLFELAKDYMNGTGKYKVIKGIISPVGDAYKKKGLI
SAHHRVIMAELATKSSEWVEVDTWESLQKEWVETAKVLRHHQEKLEAGSCDHQQDSPVRG
RPGQKRKWAEQRQDFSQKKSLEPKTKDVPKVKLLCGADLLESFGVPNLWKSEDITQIVGD
YGLVCITRAGNDAQKFIYESDALWQHRNNIHLVNEWITNDISSTKIRRALRRGQSIRYLV
PDLVQEYIEKHDLYSCESEERNVGVILAPLQRNTAEANS
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattcaaagatggaagtggttctccttgcttgtggttcctttaatcctattacc
aacatgcacctcaggctatttgagttggccaaggactacatgaacggaacaggaaaatac
aaagttatcaaaggcataatttctcctgttggtgatgcatataagaagaaaggactcatc
tctgcccaccaccgagttatcatggcagaactcgccaccaagagttcagaatgggtggaa
gttgacacctgggagagtcttcagaaggaatgggtagagacggctaaggtgctaagacac
catcaagagaaactagaggccgggagctgtgatcaccagcaggattcacctgtgcgggga
aggcctggacagaaaaggaagtgggctgaacagagacaagattttagtcaaaagaaatca
ctagagccaaaaacaaaagatgtgccaaaggtaaagctgctgtgtggggcagatctactg
gagtcctttggcgtgcccaatctgtggaaaagtgaggatatcacccaaattgtgggagac
tatggacttgtatgtattactcgggctggaaatgatgctcagaaatttatctatgaatcc
gatgcactgtggcagcatcggaacaacattcacctggtaaatgaatggatcaccaatgac
atctcctccacaaagatccggcgagctctcagaaggggccagagcattcgctacttggta
ccagaccttgtccaggagtatatcgaaaagcatgatctgtatagctgtgagagtgaagaa
aggaatgtcggggtcatcctggctcctttgcagagaaacactgcagaagctaactcataa

DBGET integrated database retrieval system