KEGG   Canis familiaris (dog): 100856749
Entry
100856749         CDS       T01007                                 

Gene name
ZFX
Definition
(RefSeq) zinc finger X-chromosomal protein isoform X1
Organism
cfa  Canis familiaris (dog)
SSDB
Motif
Pfam: Zfx_Zfy_act zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-H2C2_5 zf-C2H2_jaz zinc_ribbon_15 zf-BED zf-C2H2_11 zf-C2H2_6
Other DBs
NCBI-GeneID: 100856749
NCBI-ProteinID: XP_003640295
Ensembl: ENSCAFG00000013408
UniProt: F1PB02
Position
X
AA seq 800 aa
MDEDGLELQPQEPNSFFDATGADATHMDGDQIVVEVQETVFVSDVVDSDITVHNFVPDDP
DSVVIQDVIEDVVIEDVQCPDIMEEADVSETVIIPEQVLDSDVTEEVSLAHCTVPDDVLA
SDITSASMSMPEHVLTSESIHVSDVGHVEHVVHDSVVEAEIVTDPLTTDVVSEEVLVADC
ASEAVIDANGIPVDQQDDDKSNCEDYLMISLDDAGKIEHDGSSGMTMDAESEIDPCKVDG
TCPEVIKVYIFKADPGEDDLGGTVDIVESEPENDHGVELLDQSSSIRVPREKMVYMTVND
SQQEDEDLNVAEIADEVYMEVIVGEEDAAAAAAAAAAHEQQIDDNEIKTFMPIAWAAAYG
NNSDGIETRNGTASALLHIDESAGLGRLAKQKPKKRRRPDSRQYQTAIIIGPDGHPLTVY
PCMICGKKFKSRGFLKRHMKNHPEHLTKKKYRCTDCDYTTNKKISLHNHLESHKLTSKAE
KAIECDECGKHFSHAGALFTHKMVHKEKGANKMHKCKFCEYETAEQGLLNRHLLAVHSKN
FPHICVECGKGFRHPSELKKHMRIHTGEKPYQCQYCEYRSADSSNLKTHVKTKHSKEMPF
KCDICLLTFSDTKEVQQHALIHQESKTHQCLHCDHKSSNSSDLKRHIISVHTKDYPHKCD
MCDKGFHRPSELKKHVAAHKGKKMHQCRHCDFKIADPFVLSRHILSVHTKDLPFRCKRCR
KGFRQQNELKKHMKTHSGRKVYQCEYCEYSTTDASGFKRHVISIHTKDYPHRCEYCKKGF
RRPSEKNQHIMRHHKEVGLP
NT seq 2403 nt   +upstreamnt  +downstreamnt
atggatgaagatggacttgaattacaaccacaagagccaaactcattttttgatgcaaca
ggagctgatgctacacacatggacggtgatcaaattgttgtggaagtacaagaaactgtt
tttgtttcagatgttgtggattcagacataactgtgcataactttgttcctgatgaccca
gactcagttgtaatccaggatgtaattgaggatgttgttatagaagatgttcagtgcccc
gatatcatggaagaagcagatgtatctgaaacggtcatcattcctgagcaagtgctagac
tcagatgtaactgaagaagtttctttagcacattgcacagtcccagatgatgttttagct
tccgacattacttcagcctcaatgtctatgccagaacacgtcttgacgagtgaatctata
catgtgtctgatgttggacatgtcgaacacgtggttcatgacagtgtagtagaagcagaa
atcgtcaccgatcctctcacaacagatgtcgtttcagaagaagtattggtagcagattgt
gcctctgaagcagtcatagatgccaatggaatccctgtggaccagcaagatgatgacaaa
agcaactgtgaggactaccttatgatttccttggatgatgctggcaaaatagaacacgat
ggttcctctggaatgaccatggatgcagagtcggaaattgacccttgtaaggtggatggc
acttgcccagaagtcatcaaggtgtacatttttaaagctgaccctggagaggatgactta
ggtggcaccgtagacattgtggaaagtgagcctgagaatgatcatggagttgaattactt
gatcagagtagcagtattcgtgtgccaagggaaaagatggtttatatgactgtcaacgac
tctcagcaagaagatgaagatttaaatgttgcggaaatcgccgacgaagtttatatggag
gtgatcgtaggggaggaggatgctgcggcagctgcagcggccgctgcagcacacgagcaa
cagattgatgacaatgaaataaaaaccttcatgccaatcgcttgggcggcagcttacggt
aataattctgatggaattgaaacccggaatggcactgcaagtgccctcttgcacatagat
gagtctgctgggctcggcagactggctaaacaaaaaccaaagaaaaggagaagacctgat
tccaggcagtaccaaacagcaataattattggccctgatggacatcccttgactgtctat
ccttgcatgatttgtgggaaaaaatttaagtcgagaggttttttgaaaaggcacatgaaa
aaccatcctgaacaccttaccaagaagaagtaccgctgtactgactgtgattacactacc
aacaagaagataagtttacacaaccacctggagagccacaagctgaccagcaaagcagag
aaggccattgaatgcgacgagtgtgggaagcatttctctcatgctggggctttgtttacg
cacaaaatggtgcataaggagaaaggagccaacaaaatgcacaagtgtaaattctgtgaa
tacgagacagctgaacaagggttattgaatcgccaccttttggcggtccacagcaagaac
tttcctcatatttgtgtggagtgcggcaaaggttttcgtcacccatcagagctcaaaaag
cacatgcgaatccacactggggagaagccgtaccagtgccagtactgcgaatataggtct
gcagactcttctaacttgaaaacacatgtaaaaactaagcatagtaaagagatgccattc
aagtgtgacatctgtcttctgactttctcagataccaaagaggtgcagcaacatgctctt
atccaccaagaaagcaaaacacaccagtgtttgcactgcgaccacaagagttcgaactca
agtgatttgaaacgacacataatttcggttcacacgaaggactacccccataagtgtgac
atgtgtgataaaggctttcacaggccttctgaactcaagaaacacgtggctgcccacaag
ggtaaaaaaatgcaccagtgtagacattgtgactttaagattgcagatccatttgttcta
agtcgccatattctctcagtccacacaaaagatcttccatttaggtgtaagagatgtaga
aagggatttaggcaacagaatgagcttaaaaagcatatgaagacacacagtggcaggaaa
gtgtatcagtgtgagtactgtgagtatagcactacagatgcctcaggctttaaacggcac
gttatctccattcatacaaaagactatcctcaccgttgtgagtactgcaagaaagggttc
cgtagaccttcagaaaagaaccagcacataatgcgacatcataaagaagttggcctgccc
taa

DBGET integrated database retrieval system