KEGG   Canis familiaris (dog): 102151856Help
Entry
102151856         CDS       T01007                                 

Definition
(RefSeq) ATP synthase subunit f, mitochondrial
  KO
K02130  F-type H+-transporting ATPase subunit f
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00190  Oxidative phosphorylation
cfa01100  Metabolic pathways
cfa04714  Thermogenesis
Module
cfa_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102151856
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    102151856
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WRW
Motif
Other DBs
NCBI-GeneID: 102151856
NCBI-ProteinID: XP_005629393
Ensembl: ENSCAFG00000024413
UniProt: J9PBC9
Position
15
AA seq 88 aa AA seqDB search
MASPVPVKEKKLMEVKLGELPGWILMRDFTPKGIAGAFQRGYYRYYNKYINVKKGGVAGI
SMVLAAYVLFNYCRSYKELKHERLRKYH
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgcccgtaccagtgaaggaaaagaagcttatggaggtgaaactaggagagctg
ccaggctggatactgatgcgggatttcacccctaagggcattgctggagcttttcaaaga
ggttactaccggtattacaacaagtatatcaatgtgaagaaagggggcgttgctgggatt
tctatggtgctggctgcttatgtgcttttcaactactgtcgttcttacaaggagctcaaa
catgaacggctacgcaagtaccactga

DBGET integrated database retrieval system