KEGG   Canis lupus familiaris (dog): 102153034
Entry
102153034         CDS       T01007                                 
Name
(RefSeq) calmodulin-like protein 3
  KO
K02183  calmodulin
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04014  Ras signaling pathway
cfa04015  Rap1 signaling pathway
cfa04020  Calcium signaling pathway
cfa04022  cGMP-PKG signaling pathway
cfa04024  cAMP signaling pathway
cfa04070  Phosphatidylinositol signaling system
cfa04114  Oocyte meiosis
cfa04218  Cellular senescence
cfa04261  Adrenergic signaling in cardiomyocytes
cfa04270  Vascular smooth muscle contraction
cfa04371  Apelin signaling pathway
cfa04625  C-type lectin receptor signaling pathway
cfa04713  Circadian entrainment
cfa04720  Long-term potentiation
cfa04722  Neurotrophin signaling pathway
cfa04728  Dopaminergic synapse
cfa04740  Olfactory transduction
cfa04744  Phototransduction
cfa04750  Inflammatory mediator regulation of TRP channels
cfa04910  Insulin signaling pathway
cfa04912  GnRH signaling pathway
cfa04915  Estrogen signaling pathway
cfa04916  Melanogenesis
cfa04921  Oxytocin signaling pathway
cfa04922  Glucagon signaling pathway
cfa04924  Renin secretion
cfa04925  Aldosterone synthesis and secretion
cfa04970  Salivary secretion
cfa04971  Gastric acid secretion
cfa05010  Alzheimer disease
cfa05012  Parkinson disease
cfa05022  Pathways of neurodegeneration - multiple diseases
cfa05031  Amphetamine addiction
cfa05034  Alcoholism
cfa05133  Pertussis
cfa05152  Tuberculosis
cfa05163  Human cytomegalovirus infection
cfa05167  Kaposi sarcoma-associated herpesvirus infection
cfa05170  Human immunodeficiency virus 1 infection
cfa05200  Pathways in cancer
cfa05214  Glioma
cfa05417  Lipid and atherosclerosis
cfa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102153034
   04015 Rap1 signaling pathway
    102153034
   04371 Apelin signaling pathway
    102153034
   04020 Calcium signaling pathway
    102153034
   04070 Phosphatidylinositol signaling system
    102153034
   04024 cAMP signaling pathway
    102153034
   04022 cGMP-PKG signaling pathway
    102153034
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102153034
   04218 Cellular senescence
    102153034
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102153034
  09152 Endocrine system
   04910 Insulin signaling pathway
    102153034
   04922 Glucagon signaling pathway
    102153034
   04912 GnRH signaling pathway
    102153034
   04915 Estrogen signaling pathway
    102153034
   04921 Oxytocin signaling pathway
    102153034
   04916 Melanogenesis
    102153034
   04924 Renin secretion
    102153034
   04925 Aldosterone synthesis and secretion
    102153034
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102153034
   04270 Vascular smooth muscle contraction
    102153034
  09154 Digestive system
   04970 Salivary secretion
    102153034
   04971 Gastric acid secretion
    102153034
  09156 Nervous system
   04728 Dopaminergic synapse
    102153034
   04720 Long-term potentiation
    102153034
   04722 Neurotrophin signaling pathway
    102153034
  09157 Sensory system
   04744 Phototransduction
    102153034
   04740 Olfactory transduction
    102153034
   04750 Inflammatory mediator regulation of TRP channels
    102153034
  09159 Environmental adaptation
   04713 Circadian entrainment
    102153034
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102153034
  09162 Cancer: specific types
   05214 Glioma
    102153034
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102153034
   05163 Human cytomegalovirus infection
    102153034
   05167 Kaposi sarcoma-associated herpesvirus infection
    102153034
  09171 Infectious disease: bacterial
   05133 Pertussis
    102153034
   05152 Tuberculosis
    102153034
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102153034
   05012 Parkinson disease
    102153034
   05022 Pathways of neurodegeneration - multiple diseases
    102153034
  09165 Substance dependence
   05031 Amphetamine addiction
    102153034
   05034 Alcoholism
    102153034
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102153034
   05418 Fluid shear stress and atherosclerosis
    102153034
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cfa01009]
    102153034
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    102153034
   03036 Chromosome and associated proteins [BR:cfa03036]
    102153034
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    102153034
Protein phosphatases and associated proteins [BR:cfa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     102153034
Membrane trafficking [BR:cfa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    102153034
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     102153034
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102153034
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF-hand_4 SPARC_Ca_bdg UPF0154 Dockerin_1 EF-hand_11 EFhand_Ca_insen DUF5580_M Caleosin SurA_N_3 SurA_N_2 dCache_2
Other DBs
NCBI-GeneID: 102153034
NCBI-ProteinID: XP_005617262
Position
2:complement(27440705..27441958)
AA seq 149 aa
MADQLSEEQVAEFKEAFCLFDKDGDGAITTQELGTVMRSLGQNPTEAELRDMVGEIDRDG
NGSVDFPEFLGMMARQLKGRDSEEQIREAFRVFDKDGNGLVSAAELRHVMTRLGEKLSDE
EVDEMIRAADVDGDGQVNYEEFVHMLVSK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggccgaccagctgagcgaggaacaggtggccgagttcaaggaggccttctgcctgttt
gacaaggacggggacggggccatcaccacccaggagctgggcaccgtcatgcgctccctg
ggccagaaccccacggaggccgagctgcgggacatggtgggcgagatcgaccgggacggc
aacggctccgtggacttccccgagttcctgggcatgatggccaggcagctgaagggcagg
gacagcgaggagcagatccgcgaggccttccgcgtcttcgacaaggacggcaacggcctg
gtgagcgcggccgagctgcggcacgtgatgaccaggctgggggagaagctaagtgacgag
gaggtggacgagatgatccgggccgccgacgtggacggggacgggcaggtgaactacgaa
gagttcgtccacatgctggtgtccaagtga

DBGET integrated database retrieval system