KEGG   Canis lupus familiaris (dog): 102154062
Entry
102154062         CDS       T01007                                 

Gene name
MUC15
Definition
(RefSeq) mucin-15 isoform X1
  KO
K22019  mucin-15
Organism
cfa  Canis lupus familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    102154062 (MUC15)
Membrane trafficking [BR:cfa04131]
 Others
  Mucins
   Membrane bound mucins
    102154062 (MUC15)
SSDB
Motif
Pfam: Mucin15 Rick_17kDa_Anti
Other DBs
NCBI-GeneID: 102154062
NCBI-ProteinID: XP_005633818
Ensembl: ENSCAFG00000010162
VGNC: 43499
UniProt: E2RKU1
Position
21
AA seq 420 aa
MLPAEKQVGQVPGALLPQRLGPAAPHSAGRTLSGSGGQSHLTHPLPPSSAGSLEPGRCLG
YWGSCLETASRTWRFSLITPIQEKTTMLTSVKILLISNLFSLLLIGSHGKEILKKTTTQS
IAAGLKTMENESVPLESDTNSNSDKENKETSNPKASNSSLWDPSNKHHGTTEVFNNASTN
NFSGNLRPTPMFPTDPPLVHSFVSKLPRNSSIADENPPPVSAPPNATSAMSSEKFTWPSA
SETMKTPDNSSISVSILPAAPNTMTVTPMATEPDEWLTTSNDSFIGFTPYRETTTLQPTL
KFTNNSKIFSNTSDPQEENKNTGVVFGAILGAILGASLLSLVGYLLCGKRKTDSFSHRRL
YDDRNEPVLRLDNAPEPYDASFGNSSYYNSTVNDSSVPAGQENARDGIPMDDIPQLRTSV
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgctgccagctgagaagcaggtcggtcaggttcctggtgctctattaccccagcggctc
gggccagctgcgcctcattctgctggtcgcacactctcgggctcagggggacagtcacac
ttgacccacccgctccctccgagctcggcaggctcgctcgagccaggacgctgtctggga
tattggggttcctgcttggagacagcctccaggacctggagattctccttaataacacca
atacaagaaaagactacaatgttgacctcagtcaaaattctgttgatttcaaatttgttt
agtttactattaattggaagccacgggaaagaaattctaaaaaaaaccacaacacaaagc
attgcagcaggtttaaaaacaatggaaaatgaatctgttcctttggaaagtgatacaaat
tcaaactcagataaagaaaataaagaaacctccaatcccaaggcaagtaattcctctcta
tgggatccatcaaataaacaccatggaacaacagaagtcttcaacaatgcatcaacaaac
aacttttctgggaatctaagacccacgcctatgtttcccacagaccctcctctggtccat
agctttgtttctaaattgcctcggaactcatcgatagcagatgaaaatcctcctccagtc
tcagcacctcccaatgctacatctgctatgtcttcagaaaagttcacttggccttcagcc
agtgaaaccatgaaaactcctgacaacagttccatttcagttagcatcctccctgcagca
ccaaacaccatgactgtgacccccatggcaacagaaccagatgagtggctcaccacatcc
aatgatagcttcatagggttcaccccctaccgagaaacaacaactctacagcccacctta
aagtttaccaataattcaaaaatcttctcaaatacatcagacccccaagaagagaataaa
aatacaggagtagtatttggggccattttaggtgctattctgggtgcttcattgcttagt
cttgttggctacttgctgtgtggaaaaaggaaaacggattcattttcccatcggcgactt
tatgatgacagaaatgaaccagttctgcgattagacaatgcaccagaaccttatgacgcg
agttttgggaattctagttattacaactcaactgtgaatgattcatctgtgccagcaggc
caagaaaacgcacgtgacggcattcctatggatgacatacctcaacttcgtacctcagta
tag

DBGET integrated database retrieval system