KEGG   Canis lupus familiaris (dog): 102154566
Entry
102154566         CDS       T01007                                 

Gene name
OMD
Definition
(RefSeq) osteomodulin
  KO
K08124  osteomodulin
Organism
cfa  Canis lupus familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:cfa00535]
    102154566 (OMD)
Proteoglycans [BR:cfa00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class II
    102154566 (OMD)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRRNT LRR_5 LRR_6 LRR_9
Other DBs
NCBI-GeneID: 102154566
NCBI-ProteinID: XP_005616050
Ensembl: ENSCAFG00000002309
VGNC: 44122
UniProt: E2RNR9
Position
1
AA seq 414 aa
MGFLSRACVLFFFFGVKVYCQYESYQWDEDYDQEPDDVYQPEFPFHQNEDFQVPFHQHML
GCATECFCPPNFPSSMYCDNRKLKTIPRVPAHIQQVYLQFNEIEAVTTDSFINATHLKEI
NLSHNKITSQKIDLGVFAKLPNLLQLHLQHNNLEDFPFPLPKSLERLLLGYNEISRLQTN
AMDGLVNLTMLDLCYNQLEDSMLQEKILAKMEKLMQLNLCNNRLKSMPPGLPSSLMYLSL
ENNSISSIPENYFNELPKLQAVRMSHNKLQDIPYNIFNLSNLIELNVGHNKLKQAFYIPR
NLQHLYLQNNEIESINVTVMCPSVDPLHYHHLTYIRLDQNKLKEPITSYISLCFPYIHTI
YYGEQRSSNGQTIQLKTQVFRFQDDADSEEHEDHQEGPEQEETEENTDHHYYGS
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgggctttctaagtcgagcatgtgtccttttcttcttttttggagtcaaagtatattgc
cagtatgaaagttatcaatgggatgaagattatgatcaagaaccagatgatgtctaccaa
ccagaatttccatttcatcaaaatgaggactttcaagttccttttcatcagcatatgtta
ggctgtgccactgaatgtttctgtccacccaattttccatcatcaatgtactgtgacaat
cgcaaactcaagactatcccacgtgtcccagcacacatacagcaagtctaccttcaattc
aatgaaattgaggctgtgactacagattcattcattaatgcaacacatcttaaagaaatc
aacctcagccacaacaaaattacttctcaaaagattgatcttggtgtgtttgctaagttg
ccaaatctactacaacttcacttacagcataacaatttagaagactttccatttcctctc
cccaagtctttggaaagacttcttcttggctacaatgagatctccagattgcagacaaac
gccatggatgggctagtgaacctgacaatgcttgatctctgttataatcagcttgaggat
tccatgttacaagaaaaaatacttgccaaaatggaaaaattaatgcagctcaacctatgt
aataacagattgaaatcaatgcctcctggtctgccttcttcactgatgtacctatcttta
gaaaataattcaatttcttctataccagaaaattacttcaacgaacttcccaaacttcag
gctgtacgaatgtcacacaacaaactacaagatatcccatataatatttttaatctttcc
aacctaatagagctcaatgttggacacaacaaactgaagcaagcattttatattccaaga
aatttacaacacctatacctacagaacaatgaaatcgaaagtatcaatgttacagtgatg
tgtccgtctgttgacccactgcattaccaccatttaacatacattcgtttggaccaaaat
aagctaaaagagccaataacctcatacatttccctctgcttcccttatatacacactatt
tattatggtgagcaaagaagcagtaatggtcaaacaatacaactgaagacccaagttttc
agatttcaggatgatgctgatagtgaagaacatgaggatcaccaagaaggtccagaacaa
gaagaaacagaagaaaacactgaccatcactactatggaagttaa

DBGET integrated database retrieval system