KEGG   Canis familiaris (dog): 106557464Help
Entry
106557464         CDS       T01007                                 

Gene name
MARS2
Definition
(RefSeq) methionine--tRNA ligase, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00450  Selenocompound metabolism
cfa00970  Aminoacyl-tRNA biosynthesis
cfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    106557464 (MARS2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    106557464 (MARS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cfa01007]
    106557464 (MARS2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cfa03016]
    106557464 (MARS2)
Enzymes [BR:cfa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     106557464 (MARS2)
Amino acid related enzymes [BR:cfa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   106557464 (MARS2)
Transfer RNA biogenesis [BR:cfa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    106557464 (MARS2)
 Prokaryotic type
   Other AARSs
    106557464 (MARS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 PE
Motif
Other DBs
NCBI-GeneID: 106557464
NCBI-ProteinID: XP_013966508
Ensembl: ENSCAFG00000024359
VGNC: 43028
UniProt: E2RA59
Position
37
AA seq 593 aa AA seqDB search
MLRVRALRLLGRRRASGVSVPGSCGPRHCSSGPLGVRDDAPGARAFFTTPIFYVNAAPHI
GHLYSALLADALCRHRRLRVPSAAATRFSTGTDEHGLKIQQAAAAAGLAPAELCDRVSAQ
FQQLFREAGVSSTDFVRTTEARHRVAVQHFWGLLEARGLLYKGLYEGWYCASEECFLPEA
KVTRQPGPSGDACPVSLESGHPVSWTKEENYIFRLSQFREPLRRWLRDDPQAVTPEPFRL
AVLQWLEEELPDLSVSRRSSHLHWGIPVPGDDSQTIYVWLDALVNYLTVIGYPNAEFRAW
WPATSHIIGKDILKFHAIYWPALLLGAGMSPPHRIYVHSHWTVCGQKMSKSLGNVVDPKT
CLDRYTVDGFRYFLLRQGVPNWDCDYYDEKVVKLLDSELADALGGLLNRCTANRINPSGT
YPVFCANCFPPAPGVAGPSARAQAEDYALVNAVATLPRQVAEHYDNFQIYKALEAVSSCV
RQTNGFVQRHAPWKLSWESPVDAPWLGTVLHVALECLRVFGTLLQPVTPSLADKLLSRLG
VSATERGLGELFFLPRFYGYPCPFEGRRLGPETGLLFPRLDQSRAWLVKAHRT
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcgttcgtgccctgcggctgctcggccgccggcgggcgagcggggtgtcggtc
ccgggctcctgcggcccgcgccactgcagctcgggccctctcggtgtgcgcgacgatgcc
cccggcgcccgcgccttcttcacgacacccattttctacgtgaacgcggcgccacacatc
ggacacctgtactcggcgctgctggcggacgccctgtgccgccaccgtcgcctgcgagtc
cccagcgcggccgccacgcgattctccactggcaccgacgagcacggcttgaagattcaa
caggcagcggccgccgcgggcctggcccccgccgagctttgcgaccgagtgtctgcccag
ttccagcagcttttccgggaggctggcgtctcctccaccgacttcgtccgcaccaccgag
gcccggcaccgggtcgccgtgcagcacttctggggcttgctggaggcccggggtctgctt
tacaaggggctctatgagggctggtattgcgcctccgaagagtgcttcctgcccgaggcc
aaggtcacccggcagccgggcccgtcgggggatgcgtgtcctgtgtctctggagagtggg
catcccgtatcctggaccaaggaagaaaactacattttcaggctttcccagttccgagag
ccgcttcggcggtggctgcgggacgacccgcaggcagtcactcccgagccgtttcgtctc
gcagttctccagtggctggaggaggagctgccggacctgtcggtctctcgaaggagcagc
cacctgcactggggcattcccgtgcccggggacgattcgcagaccatctacgtgtggctg
gatgccctggtcaactaccttaccgtaattggctacccgaacgcggagttcagagcttgg
tggccagccacctctcatatcataggtaaggacattctcaaattccatgctatctattgg
cctgcgctcctcctaggggccggcatgagcccacctcatcgcatctacgtccactcccac
tggacggtctgtggccaaaagatgtccaaaagcttgggtaacgtggtggaccccaagact
tgcctcgatcgctatactgtggatggcttccgatactttcttcttcggcagggcgtcccc
aactgggactgtgattactatgatgaaaaggtggttaagttgctagattcagagctggca
gatgctctgggaggcctcctgaaccggtgcactgccaacagaataaatccttccgggaca
tacccggttttctgcgccaactgctttccccctgcgccaggggtggcggggccatcggct
cgcgctcaggctgaggactacgccttggtgaacgcagtggccaccttgcccaggcaggta
gccgagcattacgataacttccagatctataaggctctggaggccgtgtccagctgtgtc
cggcaaactaacggctttgtccaaaggcacgcaccatggaagttgagctgggagagccca
gtggatgccccctggctgggtaccgtgcttcatgtggccttggaatgtttacgagtcttt
ggaactttgctccagcctgtcaccccaagcctagctgataagctgctatccaggttggga
gtctctgccacagagaggggccttggagagctctttttcttgcctcgattctatggatat
ccatgtccttttgaagggaggaggctgggacctgaaactgggctcttgtttccaagacta
gaccagtccagggcctggctagtaaaagcccatcggacctag

DBGET integrated database retrieval system