KEGG   Canis familiaris (dog): 403445Help
Entry
403445            CDS       T01007                                 

Gene name
MMP3
Definition
(RefSeq) stromelysin-1 precursor
  KO
K01394  matrix metalloproteinase-3 (stromelysin 1, progelatinase) [EC:3.4.24.17]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04657  IL-17 signaling pathway
cfa04668  TNF signaling pathway
cfa05202  Transcriptional misregulation in cancer
cfa05215  Prostate cancer
cfa05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    403445 (MMP3)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    403445 (MMP3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    403445 (MMP3)
  09162 Cancer: specific types
   05215 Prostate cancer
    403445 (MMP3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    403445 (MMP3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cfa01002]
    403445 (MMP3)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.17  stromelysin 1
     403445 (MMP3)
Peptidases [BR:cfa01002]
 Metallo Peptidases
  Family M10
   403445 (MMP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Astacin Reprolysin_3 DUF4953 Reprolysin_4 Reprolysin_5
Motif
Other DBs
NCBI-GeneID: 403445
NCBI-ProteinID: NP_001002967
Ensembl: ENSCAFG00000015063
UniProt: Q6Y4Q5
Position
5
AA seq 478 aa AA seqDB search
MQNLPALLLFCGVVCSAYPVDRAAEDENNNMELTQQYLENYYNLGKDVKPFVRRRNSGPV
VEKIREMQKFLGLEVTGKVDSDTLAMMRRPRCGVPDVGDFTTFPGMPKWRKTHLTYRIMN
YTPDLPRDAVDSAIEKALNVWKEVTPLTFSRTDEGEADIKISFAVRDHGDFNPFDGPGNV
LGHAYPPGPGIYGDAHFDDDEQWTSDTSGTNLFLVAAHELGHSLGLFHSADPSALMYPVY
NVLADLARFHLSQDDVNGIQSLYGGPPSDSSNDPVVPTESVPPGPGTPAACDPTLSFDAI
STLRGEFLFFKDRHFWRKSLRTLEPGFYLISSFWPSLPSGLDAAYEETSKDIVFIFKGNQ
FWAMRGTEVQAGYPKGIHTLGFPPTVKKIDAAVFDKEKKKTYFFVGDKYWRFDEKRQSME
PGFPKQIAEDFPGVDSKVDAAFEAFGFYYFFNGSSQLEFDPNAKKVTHVLKSNSWLNC
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaccttccagctctactgctcttctgtggggttgtgtgctcagcctatccagtg
gacagagctgcagaggatgagaacaacaacatggaactcacccagcaatacctagaaaac
tactacaaccttgggaaagatgtgaaaccatttgtcagaagaaggaacagtggtcctgtc
gttgaaaaaatccgagaaatgcagaagttcctcgggttggaggtgacagggaaggtggac
tcggacaccctggcgatgatgcgcaggcccaggtgtggcgttcctgacgtcggtgacttc
accaccttccctggcatgcccaagtggaggaaaactcaccttacttacagaatcatgaat
tatacaccagatttgccaagagatgctgttgattctgccattgagaaagctctgaatgtc
tggaaggaggtgactccacttactttctccaggactgatgaaggagaggctgacataaag
atttcttttgcagttagagatcacggagactttaacccttttgatggacctggaaatgtt
ttgggtcatgcctacccacctgggcctggcatttatggagatgcccactttgacgatgat
gaacaatggacaagcgatacatcaggaaccaatttattcctcgttgctgctcatgagctt
ggccattccctgggtctctttcactcggctgaccctagcgctctgatgtacccagtctac
aatgtattggcagatctggcccgcttccatctttctcaagatgatgtgaatggcatccag
tccctgtatggtggacctccctctgattcctccaatgaccccgtggtgcccacggaatct
gtgcctccaggacctgggacaccagctgcatgtgaccccactttgtccttcgacgcaatc
agcaccctgaggggagagttcctgttctttaaagacagacatttttggcgaaaatccctc
aggacacttgaacctgggttctatttaatctcttcattttggccatcccttccttcaggc
ttggatgccgcatatgaagagactagcaaggatattgttttcatttttaaaggaaatcag
ttctgggccatgagaggaactgaggtacaagccggttatccaaaaggcatccacaccctg
ggttttcctccaaccgtgaagaaaattgatgcagctgtttttgataaggagaagaagaaa
acgtacttcttcgtaggagacaaatactggcgatttgatgagaagagacaatccatggag
ccaggctttcccaagcaaatagcagaagactttccaggggttgactcgaaggttgatgct
gcgtttgaggcatttgggttttactacttcttcaatggatcttcacagttggagtttgac
ccaaatgcaaagaaagtgacacatgttttgaagagcaacagctggcttaattgttga

DBGET integrated database retrieval system