KEGG   Canis familiaris (dog): 403453Help
Entry
403453            CDS       T01007                                 

Gene name
ABCC1
Definition
(RefSeq) multidrug resistance-associated protein 1
  KO
K05665  ATP-binding cassette, subfamily C (CFTR/MRP), member 1 [EC:7.6.2.3]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa01523  Antifolate resistance
cfa02010  ABC transporters
cfa04071  Sphingolipid signaling pathway
cfa04977  Vitamin digestion and absorption
cfa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    403453 (ABCC1)
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    403453 (ABCC1)
 09150 Organismal Systems
  09154 Digestive system
   04977 Vitamin digestion and absorption
    403453 (ABCC1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    403453 (ABCC1)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    403453 (ABCC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cfa02000]
    403453 (ABCC1)
Enzymes [BR:cfa01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.3  ABC-type glutathione-S-conjugate transporter
     403453 (ABCC1)
Transporters [BR:cfa02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    403453 (ABCC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N MMR_HSR1 AAA_16 RsgA_GTPase AAA_25 AAA_22 PHO4 Zeta_toxin AAA_29 NB-ARC Dynamin_N
Motif
Other DBs
NCBI-GeneID: 403453
NCBI-ProteinID: NP_001002971
Ensembl: ENSCAFG00000018208
UniProt: Q6UR05
Position
6
AA seq 1531 aa AA seqDB search
MALRGFCSADGSDPFWEWDVSWNTSNPDFTKCFQNTVLVWVPCCYLWLCFPFYFLYLSRH
DRGYIQMTYLNKTKTALGFVLWIVCWADLFYSFWERSWGKILAPVFLVSPTLLGITMLLA
TFLIQLERRKGVQSSGIMLTFWLIALLCALAILRSKIMTALKEDAEIDVFRDVTFYIYFS
LVLIQLVLSCFSDRPPLFSETIHDLNPCPESSASFLSRVTFWWITGLMVRGYRQPLESTD
LWSLNKEDTSEQVVPVLVKNWKKECAKSKRQQRKITYSSKDPAKPKGGSQVDVNEEAEVL
IVKTPQKEREPSLFKVLYKTFGPYFLMSFLFKALHDLMMFAGPEILKLLINFVNDKKAPD
WQGYLYTALLFICACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTV
GEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMILMVPLN
AVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLK
KSAYLAAVGTFTWVCTPFLVALSTFAVYVTVDKNNILDAQKAFVSLALFNILRFPLNILP
MVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGANSITVKNATFTWARSDPPT
LSGITFSIPEGSLVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQND
SLRENILFGRQLQERYYKAVIEACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLAR
AVYCDSDIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRLLVTHSISYLPQVDVIIV
MTGGKISEMGSYQELLARDGAFAEFLRTYASGDQEQAEQDDGLTGVSSPGKEVKQMENGM
LVTDVAGKQLQRQLSNSSSYSGDVSRHHTSTAELQKAGPKNEDAWKLVEADKAQTGQVKL
SVYWDYMKAIGLFISFLSIFLFLCNHVASLVSNYWLSLWTDDPIVNGTQEHTKIRLSVYG
ALGISQGITVFGYSMAVSIGGIFASRRLHVDLLQNVLRSPMSFFERTPSGNLVNRFSKEL
DTVDSMIPQVIKMFMGSLFNVIGACIIILLATPIASIIIPPLGLIYFFVQRFYVASSRQL
KRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIRQSDLKVDENQKAYYPSIVANRWLA
VRLECVGNCIVLFAALFSVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVA
VERLKEYSETEKEAPWQIQEMAPPSTWPQVGRVEFRDYGLRYRENLDLVLKHINITINGG
EKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDDINIAKIGLHDLRVKITIIPQDPVLF
SGSLRMNLDPFSQYSDEEVWTSLELAHLKDFVSGLPDKLNQECAEGGENLSVGQRQLVCL
ARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFDDCTVLTIAHRLNTIMDYTRVIVL
DKGEIRECGQPSDLLQQRGLFYSMAKDAGLV
NT seq 4596 nt NT seq  +upstreamnt  +downstreamnt
atggcgctccgcggcttctgcagcgccgacggctccgaccccttctgggagtgggatgtc
tcgtggaataccagcaaccccgacttcaccaagtgctttcagaacacggtcctcgtgtgg
gtgccttgttgttacctctggctctgcttccccttctacttcctctatctctcgcgccat
gaccgaggctacattcagatgacatatctcaataaaaccaaaactgccttgggatttgtg
ctatggatcgtctgctgggcagacctcttctactctttctgggaaagaagttggggcaaa
atcctggccccggtgtttctggtcagcccaaccctcttgggcatcactatgctgcttgct
acctttttaattcagctcgagagaaggaagggagtccagtcctcggggatcatgctcact
ttctggcttatagccctactgtgtgcccttgccatcttgagatccaaaatcatgactgcc
ttaaaagaggatgctgaaatcgacgtgtttcgtgatgtcactttctacatttacttttcc
ctcgtgctgattcagctcgtgttgtcctgcttctcagaccgaccgcccctgttctctgaa
accatccatgacctcaatccctgcccggagtccagtgcctctttcctttccagagtcacc
ttctggtggatcacagggttgatggtccgaggctaccgccagcccctggaaagcactgac
ctttggtccctgaataaggaggacacgtcagaacaagtggtgcctgttctggtaaagaac
tggaagaaggagtgtgccaaatccaaaagacagcagaggaagatcacatactcctccaag
gatcctgccaagccaaaagggggctcccaggtggacgtgaacgaggaggctgaggtgttg
attgttaagaccccacagaaggagcgcgagccgtctctattcaaggtgttatacaagacc
ttcgggccctacttcctcatgagcttcttattcaaggccctccatgacctgatgatgttt
gctggcccagagatcttaaagttgctcatcaacttcgtgaacgacaagaaggccccggac
tggcagggctacctgtacactgcgctgctcttcatctgcgcctgcctgcagaccctcgtg
ctgcaccagtacttccacatctgcttcgtcagcggcatgaggatcaagacagccgtcatc
ggggccgtgtaccggaaggcattggtgatcaccaactcagccagaaaatcctccaccgtc
ggggagattgtaaacctcatgtctgtggacgcccagcggttcatggacctggccacgtac
attaacatgatctggtcagctcctctgcaagtcatccttgctctctacctcctgtggctg
aacctgggcccgtctgtcctggctggggtggctgtgatgatcctcatggttccgctcaat
gccgtgatggccatgaagactaagacctaccaggtggcgcacatgaagagcaaagacaac
cggatcaagctgatgaatgagattctcaacgggatcaaagtgctaaagctgtacgcctgg
gaactggccttcaaagacaaagtcctggccatcaggcaggaggagctcaaggtgctgaag
aaatcggcctacctggccgccgtggggaccttcacctgggtctgcacgccatttctggtg
gccttgtctacatttgctgtctacgtgaccgtcgacaagaacaacatcctcgacgcccag
aaagctttcgtgtccttggccttgttcaacatcctccggttccctctgaatattctcccc
atggtcatcagcagcatcgtgcaggcaagtgtctccctcaaacgcctccggatcttcctg
tctcacgaggagctagagcctgacagcattgagcgaaggcccgtcaaagacggcgggggc
gccaacagcatcactgtgaagaatgccacgttcacgtgggcccggagcgaccctccaacg
ctaagcggcatcaccttctccattccggaaggttccttggtggccgtggtgggccaggtg
ggctgcggaaagtcgtctctgctctcggcactcctggcggagatggacaaggtggagggg
catgtggctatcaagggctcagtggcctacgtcccccagcaggcctggattcagaatgat
tctctccgagaaaacatccttttcggacgccagctacaggaacggtattataaggctgtg
attgaagcctgtgccctcctcccagatctggaaatcctgcccagcggggaccggacagag
attggtgagaagggcgtgaacctgtctgggggccagaagcagcgagtgagcctggcgcgg
gccgtgtactgtgactctgacatctacctcttcgatgatcctctgtcagcagtggatgct
catgtgggaaaacacatatttgaaaatgtgattggccccaaggggatgctaaagaataag
acgcggctcctggtcacgcacagcatcagttacctgccccaggtggatgtcatcattgtc
atgaccggtggcaagatctcggagatgggctcctaccaggagctgctggcccgggatgga
gccttcgccgaattccttcgcacgtacgccagcggcgatcaggagcaggccgagcaggat
gacgggttaacaggtgtcagcagtcccgggaaggaggtgaagcagatggagaatggcatg
ctggtgacggatgtggcggggaagcagctgcagagacagctcagcaactcctcctcctac
agcggggacgtgagccgccaccacaccagcacggctgagctgcagaaagccggtcccaag
aatgaggacgcctggaagctggtggaagcagacaaggctcaaacggggcaggtcaagctg
tccgtgtactgggactacatgaaggcgatcgggcttttcatctcctttctgagcatcttc
cttttcctgtgtaaccacgttgcctccctggtctcgaactactggctcagcctctggacc
gacgaccccatcgtcaacgggacccaggagcatactaaaatccggctgagcgtctatgga
gccctgggcatttcgcaaggtatcacggtgttcggctactccatggcggtgtccatcggg
gggatcttcgcttcccgccgcctgcacgtcgacctgctacagaacgtcctccggtccccc
atgagcttcttcgagcggacccccagtgggaacctggtgaaccgcttctctaaggagctg
gacacggtggactcgatgatcccacaagtcatcaagatgttcatgggctccctgttcaat
gtcatcggcgcctgcatcatcatcctgctggccactcccatcgcctccatcatcatccca
ccactaggcctcatctatttctttgtgcagaggttttacgtggcctcctcccggcagctg
aagcgcctcgagtcggtcagccgctccccggtgtactcccacttcaatgagaccttgctg
ggggtcagcgtcatccgtgccttcgaggagcaggagcgcttcatccgccagagtgacctg
aaggtggacgagaaccagaaggcctattaccccagcatcgtggccaacaggtggctggcc
gtgcggctggagtgtgtaggcaactgcatcgtcctgttcgctgccctgttctccgtgatc
tccaggcacagtctcagcgctggcttggtgggcctgtccgtgtcctactccctgcaggtc
accacgtacttgaactggctggttcgcatgtcatccgagatggagaccaacatcgtggcc
gtggagaggctgaaggagtattcagaaacggagaaagaggctccctggcaaatccaggag
atggctccgcccagcacctggcctcaggtgggccgagtggaattccgggactacggcctc
cgctaccgagaaaacctggacttggttctcaagcacatcaacatcaccatcaacggaggg
gaaaaggtgggcatcgtggggcggacgggagctgggaagtcgtccctgaccctgggcttg
tttcggatcaatgagtctgccgagggggagatcattatcgacgatatcaatattgccaag
atcggcctgcatgacctgcgcgtcaagatcaccatcatcccgcaggaccctgtgttgttc
tcgggttcgctccgcatgaacctggacccattcagccagtactcagacgaagaagtctgg
acgtccctggagctggctcacctgaaggacttcgtgtcaggccttcccgataagctgaac
caagagtgtgcagagggcggggagaacctgagcgtcgggcagcgccagctcgtgtgcctg
gcccgggctctgctgaggaaaaccaagatcctcgtgttggacgaggccacggcggccgta
gacctagaaaccgatgacctcattcagtctaccatccggacgcagtttgacgactgcacc
gtcctcaccatcgcgcaccgcctcaacaccatcatggactacacaagggtgatcgtcctg
gacaagggagagatccgagagtgcggccagccctccgacctcctacagcagagaggtctc
ttctacagcatggccaaagatgctggcctggtgtga

DBGET integrated database retrieval system