KEGG   Canis familiaris (dog): 403461Help
Entry
403461            CDS       T01007                                 

Gene name
BDNF
Definition
(RefSeq) brain-derived neurotrophic factor precursor
  KO
K04355  brain-derived neurotrophic factor
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04010  MAPK signaling pathway
cfa04014  Ras signaling pathway
cfa04024  cAMP signaling pathway
cfa04151  PI3K-Akt signaling pathway
cfa04722  Neurotrophin signaling pathway
cfa05016  Huntington's disease
cfa05030  Cocaine addiction
cfa05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    403461 (BDNF)
   04010 MAPK signaling pathway
    403461 (BDNF)
   04024 cAMP signaling pathway
    403461 (BDNF)
   04151 PI3K-Akt signaling pathway
    403461 (BDNF)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    403461 (BDNF)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    403461 (BDNF)
  Substance dependence
   05030 Cocaine addiction
    403461 (BDNF)
   05034 Alcoholism
    403461 (BDNF)
Cytokines and growth factors [BR:cfa04052]
 Growth factors
  Growth factors (RTK binding)
   403461 (BDNF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NGF Spaetzle
Motif
Other DBs
NCBI-GeneID: 403461
NCBI-ProteinID: NP_001002975
UniProt: Q7YRB4
Position
21
AA seq 247 aa AA seqDB search
MTILFLTMVISYFGCMKAAPMKEASVRGQGSLAYPGVRTHGTLESVSGPKAGSRGLTSLA
DTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAA
NMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQY
FYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCT
LTIKRGR
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccttttccttactatggttatttcatacttcggttgcatgaaggctgccccc
atgaaagaagcgagcgtccgaggacaaggcagcttggcctacccaggtgtgcggacccat
gggactctggagagcgtgagtgggcccaaggcgggttccagaggcctgacgtcgttggcc
gacacttttgaacacgtgatagaagagctgttggacgaggaccagaaggttcggcccaat
gaagagaacaataaggacgcggacttgtatacctcccgggtgatgctcagcagtcaagtg
cctttggagcctcctcttctctttctgcttgaggaatacaaaaattacctggatgctgca
aacatgtcgatgagggtccggcgccactccgaccccgcccgccgcggggagctgagcgtg
tgcgacagcattagcgagtgggtgacagcggcagacaaaaagactgcagtggacatgtcg
ggcgggacggtcaccgtcctcgaaaaagtccctgtgtcgaaaggccaactgaagcagtac
ttctacgagaccaagtgcaatcccatgggttacacgaaggagggctgcaggggcatagac
aaaaggcattggaactcccagtgccgaactacccagtcgtacgtgcgggcccttaccatg
gatagcaaaaagagaattggctggcggttcataaggatagacacttcctgtgtgtgtaca
ctgaccattaagaggggaagatag

DBGET integrated database retrieval system