KEGG   Canis lupus familiaris (dog): 403571
Entry
403571            CDS       T01007                                 

Gene name
GCG
Definition
(RefSeq) glucagon precursor
  KO
K05259  glucagon
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04024  cAMP signaling pathway
cfa04080  Neuroactive ligand-receptor interaction
cfa04714  Thermogenesis
cfa04911  Insulin secretion
cfa04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    403571 (GCG)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    403571 (GCG)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    403571 (GCG)
   04922 Glucagon signaling pathway
    403571 (GCG)
  09159 Environmental adaptation
   04714 Thermogenesis
    403571 (GCG)
SSDB
Motif
Pfam: Hormone_2 Lipoprotein_10 MPM1 CortBP2
Other DBs
NCBI-GeneID: 403571
NCBI-ProteinID: NP_001003044
Ensembl: ENSCAFG00000010414
VGNC: 41143
UniProt: P29794
Position
36
AA seq 180 aa
MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSAPQTEPLNDLDQMNEDKRHSQGTFTS
DYSKYLDSRRAQDFVQWLMNTKRNKNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFI
AWLVKGRGRRDFPEEVAIVEEFRRRHADGSFSDEMNTVLDTLATRDFINWLLQTKITDRK
NT seq 543 nt   +upstreamnt  +downstreamnt
atgaaaagcatttactttgtggctggattgtttgtaatgctggtacaaggcagctggcaa
cgttctcttcaagacacagaggagaaatccagatcattctcagctcctcagacagagccg
ctcaatgatctggatcagatgaatgaagacaagcgtcattctcagggtacattcaccagt
gactacagcaagtatctggactccaggcgtgcccaggatttcgtgcagtggttgatgaac
accaagaggaacaagaataacattgccaaacgtcatgatgaatttgagagacatgctgaa
gggacctttaccagtgatgtaagttcttatttggaaggccaagctgccaaggaattcatt
gcttggctggtgaaaggccggggaaggcgagatttcccagaagaagttgccattgttgaa
gaattccgtcgcagacacgccgacggttccttctctgatgagatgaacacagttcttgat
actcttgccacccgggactttataaactggctgcttcagaccaaaattactgacaggaag
taa

DBGET integrated database retrieval system