KEGG   Canis lupus familiaris (dog): 403585
Entry
403585            CDS       T01007                                 

Gene name
SAA1
Definition
(RefSeq) serum amyloid A1 precursor
  KO
K17310  serum amyloid A protein
Organism
cfa  Canis lupus familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    403585 (SAA1)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   403585 (SAA1)
SSDB
Motif
Pfam: SAA
Other DBs
NCBI-GeneID: 403585
NCBI-ProteinID: NP_001003050
Ensembl: ENSCAFG00000009135
UniProt: P19708
Position
21
AA seq 109 aa
MKLFPGLLFCSLVLGVSGQWYSFVSEAAQGAWDMWRAYSDMREANYKNSDKYFHARGNYD
AAQRGPGGAWAAKVISDARENSQRITDRLKFGDSGHGAEDSKADQAANE
NT seq 330 nt   +upstreamnt  +downstreamnt
atgaagcttttcccgggcctccttttctgttccttggtcctgggtgtcagcggccaatgg
tattcatttgtcagtgaggctgctcaaggggcttgggacatgtggagagcctactctgac
atgagagaagccaactacaaaaattcagacaaatacttccatgcccgggggaactatgac
gctgcacagaggggccctgggggcgcctgggctgctaaagtgatcagcgacgccagagag
aattctcagagaatcacagaccgtcttaagtttggagacagcggccacggagcggaagac
tcgaaggctgaccaggctgccaacgaatga

DBGET integrated database retrieval system