KEGG   Canis lupus familiaris (dog): 403589
Entry
403589            CDS       T01007                                 

Gene name
PTGER4
Definition
(RefSeq) prostaglandin E2 receptor EP4 subtype
  KO
K04261  prostaglandin E receptor 4
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04080  Neuroactive ligand-receptor interaction
cfa04750  Inflammatory mediator regulation of TRP channels
cfa04924  Renin secretion
cfa05163  Human cytomegalovirus infection
cfa05165  Human papillomavirus infection
cfa05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    403589 (PTGER4)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    403589 (PTGER4)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    403589 (PTGER4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    403589 (PTGER4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    403589 (PTGER4)
   05165 Human papillomavirus infection
    403589 (PTGER4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cfa04030]
    403589 (PTGER4)
G protein-coupled receptors [BR:cfa04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    403589 (PTGER4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx NdhL
Other DBs
NCBI-GeneID: 403589
NCBI-ProteinID: NP_001003054
Ensembl: ENSCAFG00000018619
VGNC: 45144
UniProt: Q9TU16
Position
4
AA seq 492 aa
MSTPGANASASSTPDRPNSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCG
LAVTDLLGTLLVSPVTIATYMKGQWPGGEALCEYSTFILLFFSLSGLSIICAMSIERYLA
INHAYFYSHYVDKRLAGLTLVAVYASNVLFCALPNMGLGSSRLQYPDTWCFIDWTTNVTA
HAAFSYMYAGFSSFLILATVLCNVLVCGALLRMHRQFMRRTSLGTEQHPAAGALAVPSAL
CRSHPAAAAPSPALPRLSDFRRRRSFRGIAGAEIQMVILLIATSLVVLICSIPLVVRVFI
NQLYQPRLVKEISKNPDLQAIRIAAVNPILDPWIYILLRKTVLSKAIEKIKCLFCRIGGS
RRDRSGQHCSESRRTSSAMSGHSRSFLSRELKETSSTSQTLLYMPDLSENGLGGRNLLPG
VPGMGLPQADTTSLRTLRISETSDSSQGQDSESVLLVDEVGGSSHQSGPGPKGNSLQVTF
PNETLNLSEKCI
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgtccactcccggggccaatgcgtccgcctcctccacccccgaccgtccgaacagcccg
gtgaccatcccggcggtgatgttcatcttcggggtagtgggcaacctggtggccatcgtg
gtgctgtgcaagtcgcgcaaggagcagaaggagacgaccttctacacgttggtgtgcggg
ctggccgtcaccgacctgctgggcacgttgctggtgagtccggtgaccatcgccacgtac
atgaagggccagtggccgggaggcgaggccctctgcgagtacagcaccttcatcctgctc
ttcttcagcctgtccggcctcagcatcatctgtgccatgagtatcgagcgctacctggcc
atcaaccacgcctacttctacagccactacgtggacaagcggctggcgggcctcacgctc
gtcgcggtctatgcgtccaacgtgctcttctgcgcgctgcccaacatgggcctgggcagc
tcgcggctgcagtacccggacacctggtgcttcatcgactggaccaccaacgtgacggcg
cacgccgccttctcctacatgtacgcgggcttcagctccttcctcattctggccacggtg
ctgtgcaacgtgctggtgtgcggcgcgctgctccgcatgcaccgccagttcatgcgccgc
acgtcgctgggcacggagcagcaccccgcggcgggcgcgctcgcggtgccctccgcgctc
tgccgcagccacccggccgccgccgccccctcccccgcgctgccgcgcctcagcgacttt
cgccgccgccggagtttccgcgggatagcgggcgccgagatccagatggtcatcctgctc
atcgccacctccctggtggtgctcatctgctccatcccgctcgtggtacgggtgttcatc
aaccagttatatcagccacgtttggtgaaagaaatcagcaaaaacccagacttgcaggcc
atccgaattgctgctgtgaaccctatcctggacccctggatatacatccttctgcggaag
accgtgctcagcaaagcaatagagaagattaaatgcctcttctgccgcatcggcgggtcc
cgcagagaccgctcgggacagcactgctcagagagcagaaggacatcctctgccatgtcc
ggccactctcgctccttcctctcccgggagctgaaggagaccagcagcacatctcagacc
ctcctctacatgcccgacctcagcgaaaacgggcttggaggcaggaatctgcttcccggt
gtccctggcatgggcctgccccaggcagacaccacctccctgaggactttgcgaatatcc
gagacctcggactcctcccaggggcaggattcagagagtgttttattggtggacgaggtt
ggtggaagcagccaccagtctggccctggcccaaaggggaactctctgcaagtcactttt
cccaatgaaacactgaacttatcagagaaatgtatatag

DBGET integrated database retrieval system