KEGG   Canis lupus familiaris (dog): 403619
Entry
403619            CDS       T01007                                 

Gene name
FABP1
Definition
(RefSeq) fatty acid-binding protein, liver
  KO
K08750  fatty acid-binding protein 1, liver
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa03320  PPAR signaling pathway
cfa04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    403619 (FABP1)
  09154 Digestive system
   04975 Fat digestion and absorption
    403619 (FABP1)
SSDB
Motif
Pfam: Lipocalin_7 Lipocalin
Other DBs
NCBI-GeneID: 403619
NCBI-ProteinID: NP_001273980
Ensembl: ENSCAFG00000007413
VGNC: 40558
UniProt: F1P9C9
Position
17
AA seq 127 aa
MNFSGKYQLQSQENFEAFMKAVGLPDELIQKGKDLKGVSEIVQNGKHFKLIITTGSKVIQ
NEFTLGEECELETMTGEKVKAVVQMEGDNKLVTTFKGIKSVTELNGDVITNTMTLGDIVF
KRISKRI
NT seq 384 nt   +upstreamnt  +downstreamnt
atgaacttctccggcaagtaccaactgcagagccaagaaaactttgaggccttcatgaag
gcagtcggtctgcctgatgaactcatccagaaggggaaggacctcaagggggtgtcagaa
atcgtgcagaatgggaagcacttcaagctcatcatcaccactggttccaaagtgatccag
aatgagttcaccttgggggaagagtgtgagctggagaccatgactggagagaaggtcaag
gcagtggttcagatggaaggtgacaataagctggtgacaactttcaaaggcatcaagtct
gtgaccgaactcaatggcgatgtgatcaccaataccatgacattgggtgacattgtcttc
aagagaatcagcaagagaatttag

DBGET integrated database retrieval system