KEGG   Canis familiaris (dog): 403626Help
Entry
403626            CDS       T01007                                 

Gene name
LPL
Definition
(RefSeq) lipoprotein lipase
  KO
K01059  lipoprotein lipase [EC:3.1.1.34]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00561  Glycerolipid metabolism
cfa01100  Metabolic pathways
cfa03320  PPAR signaling pathway
cfa04979  Cholesterol metabolism
cfa05010  Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    403626 (LPL)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    403626 (LPL)
  Digestive system
   04979 Cholesterol metabolism
    403626 (LPL)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    403626 (LPL)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     403626 (LPL)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   403626 (LPL)
  Exosomal proteins of breast milk
   403626 (LPL)
Glycosaminoglycan binding proteins [BR:cfa00536]
 Heparan sulfate/Haparin
  Enzymes
   403626 (LPL)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cfa00537]
 Enzymes
  403626 (LPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase PLAT Abhydrolase_6 Abhydrolase_1 W2
Motif
Other DBs
NCBI-GeneID: 403626
NCBI-ProteinID: XP_005635791
Ensembl: ENSCAFG00000010161
VGNC: 42754
UniProt: F1PF96
Position
25
AA seq 471 aa AA seqDB search
MESRALLLVALGMWLQSLAAAARIPGGNDFVDIESKFALRTPEDTAEDTCHLIPGVIESV
ANCHFNHTSKTFVVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQQHYPVS
AGYTKLVGKDVAKFINWLAEEFQYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRITGLDP
AGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQPGCN
IGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSKEAFEKGLCLS
CRKNRCNNMGYEINKVRAKRGSKMYLKTRSQMPYKVFHYQVKIHFSGTESDAQTNQAFEI
SLYGTVAESENIPFTLPEVSANKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDWWSSP
GFAIEKIRVKAGETQKKVIFCSREKVSHLQKGKSSVVFVKCHDKSLNKKSG
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggagagcagagccctactcctggtggccctgggcatgtggctgcagagtctggccgcc
gccgcccgaattccaggaggaaatgattttgtagatatcgaaagtaaatttgctctaagg
acccctgaagacacagctgaggatacctgccacctcattcccggagtgatagaatctgtg
gctaactgccacttcaatcacaccagcaagacctttgtggtgatccatggctggacggtg
acaggaatgtatgagagttgggtgccaaaacttgtggctgccctgtacaagagggaaccg
gactccaatgtcattgtggtggactggctgtcacgagcccagcagcattatccagtgtct
gcagggtacaccaagctggtgggaaaagatgtggccaagttcatcaactggttggcggag
gaatttcagtatcctctggacaatgtccatcttttgggatacagccttggagcgcatgct
gctggcattgcaggaagtctgaccaataagaaggtcaatagaattactggtctagatcca
gctggacctaactttgagtatgcagaagctccaagtcgtctttctcctgatgatgcagat
tttgtagatgtcttacacacattcacaagagggtcacctggccgaagtattggaatccag
aaaccagtaggacatgttgatatttatcctaatggaggcacttttcaaccaggatgtaac
attggggaagccatccgtgtgattgcagagagaggccttggagatgtggaccagctagtg
aaatgctcccatgagcggtccattcacctctttattgactctctgctgaatgaagaaaat
ccaagtaaggcctaccggtgcaactcaaaggaagcctttgagaaagggctttgcctgagt
tgcagaaagaaccgttgcaacaacatgggctatgagatcaataaggtcagagccaaaaga
ggcagcaaaatgtacctgaagactcgctctcagatgccttacaaagtcttccattaccaa
gtaaagatacatttttctgggactgagagtgatgcacagaccaaccaggccttcgagatc
tctctgtatggcactgtggctgagagtgagaacatcccttttaccctgcctgaagtttct
gctaataagacatactcttttctaatttacacggaggtggatattggagaactgctaatg
ttgaaactcaaatggaagagtgattcatacttcagctggtcagactggtggagcagccct
ggctttgctattgagaagatcagagtaaaagctggagagactcagaaaaaggtaatcttc
tgttccagggagaaagtgtctcatctgcagaaaggaaagtcgtctgtggtatttgtgaaa
tgccatgacaagtctctgaataagaagtctggctga

DBGET integrated database retrieval system