KEGG   Canis familiaris (dog): 403635Help
Entry
403635            CDS       T01007                                 

Gene name
DIO1
Definition
(RefSeq) type I iodothyronine deiodinase
  KO
K01562  type I thyroxine 5'-deiodinase [EC:1.21.99.4]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04919  Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    403635 (DIO1)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.21  Catalysing the reaction X-H + Y-H = X-Y
   1.21.99  With unknown physiological acceptors
    1.21.99.4  thyroxine 5'-deiodinase
     403635 (DIO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: T4_deiodinase SWIM
Motif
Other DBs
NCBI-GeneID: 403635
NCBI-ProteinID: NP_001007127
UniProt: P49894
Position
5
AA seq 244 aa AA seqDB search
MGLPRPVLWLRRLWVLLQVAVQVAVGKVFLKLFPARVKQHIVAMNGKNPHFSYDNWAPTL
YSMQYFWFVLKVQWQRLEDRTEPGGLAPNCPVVRLSGQRCNIWDFMQGNRPLVLNFGSCT
UPSFLFKFDQFKRLIEDFCSTADFLIIYIEEAHASDGWAFKNNVNIRTHQTLQDRLQAAR
LLLDRAPPCPVVVDTMRNQSSQFYAALPERLFVLQEGRILYKGKPGPWNYHPEEVRAVLE
KLHS
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggggctgccccggccagtgctgtggctaaggaggctctgggtcctcttgcaggtggcc
gtgcaggtggccgtgggcaaagtgttcctgaaactgtttcccgcaagagtcaagcaacac
atcgtggccatgaatgggaagaaccctcacttttcctatgacaactgggcccccaccctc
tacagcatgcagtacttctggtttgtcctgaaagtccaatggcagcgactagaggacagg
actgagccaggaggtctggcccccaactgccctgtggtccggctctcgggacagaggtgc
aacatttgggacttcatgcaaggcaacaggccattggtgctcaattttggaagttgtacc
tgaccttcatttcttttcaaatttgaccaattcaagagacttattgaagacttctgctcc
acagcagactttctcatcatttacatcgaagaagcacatgcatcagatggctgggccttt
aagaacaacgtgaacatcaggactcaccagactctccaggaccgcctgcaggcagcccgc
ttgctgctggacagggcccccccatgccccgtggtggtggacacgatgaggaaccaaagc
agccagttctacgcggccctacccgagaggctcttcgtgctccaggagggcaggatcctc
tacaagggtaaacctggcccttggaactaccatcccgaggaagttcgtgctgttctggaa
aaactgcacagttag

DBGET integrated database retrieval system