KEGG   Canis lupus familiaris (dog): 403656
Entry
403656            CDS       T01007                                 

Gene name
ANGPT1
Definition
(RefSeq) angiopoietin-1 precursor
  KO
K05465  angiopoietin 1
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04010  MAPK signaling pathway
cfa04014  Ras signaling pathway
cfa04015  Rap1 signaling pathway
cfa04066  HIF-1 signaling pathway
cfa04151  PI3K-Akt signaling pathway
cfa05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    403656 (ANGPT1)
   04014 Ras signaling pathway
    403656 (ANGPT1)
   04015 Rap1 signaling pathway
    403656 (ANGPT1)
   04066 HIF-1 signaling pathway
    403656 (ANGPT1)
   04151 PI3K-Akt signaling pathway
    403656 (ANGPT1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    403656 (ANGPT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cfa04052]
    403656 (ANGPT1)
Cytokines and growth factors [BR:cfa04052]
 Growth factors
  Growth factors (RTK binding)
   403656 (ANGPT1)
SSDB
Motif
Pfam: Fibrinogen_C F_actin_bind
Other DBs
NCBI-GeneID: 403656
NCBI-ProteinID: NP_001005754
Ensembl: ENSCAFG00000000693
VGNC: 37854
UniProt: Q60FC1
Position
13
AA seq 497 aa
MTVFLSFAFLAAILTHIGCSNQRRSPENGGRRYNRIQHGQCAYTFILPEHDGNCRESTTD
QYNTNALQRDAPHVGPDFSSQKLQHLEHVMENYTQWLQKIENYIVENMKSEMAQIQQNAV
QNHTATMLEIGTSLLSQTAEQTRKLTDVETQVLNQTSRLEIQLLENSLSTYKLEKQLLQQ
TNEILKIHEKNSLLEHKILEMEGKHKEEWDTLKEERENLQVLVTRQTYIIQELEKQLNRA
TNNNSVLQKQQLELMDTVHNLVNLCTKEVLLKGGKKEEEKPFRDCADVYQAGFNKSGIYT
IYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEF
IFAITSQRQYTLRIELMDCEGNRAYSQYDRFHIGNEKQNYRLYLKCHTGTAGKQSSLILH
GADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKG
PSYSLRSTTMMIRPLDF
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgacagttttcctttcctttgctttcctcgctgccattctgactcacatagggtgcagc
aaccagcgccgaagtccagaaaacggtgggagaagatataaccggattcaacatgggcaa
tgtgcctacactttcattcttccagaacacgacgggaactgtcgtgagagtacgacagac
cagtacaacacaaacgctctgcagagagatgctccacacgtgggaccggatttctcttcc
cagaaacttcaacatctggagcatgtgatggaaaattatactcagtggctgcaaaaaatt
gagaattacattgtggaaaatatgaagtcggagatggcccagatacagcagaatgcagtt
cagaaccacacggccaccatgctcgagataggaaccagcctcctctctcagactgcagag
cagaccagaaagctgacagatgttgagacccaggtactaaatcaaacttctcgacttgaa
atacaactgctagagaattcattatcaacatacaagctagagaagcagcttcttcaacag
acaaatgaaatcctaaagattcatgagaaaaacagtttattagaacataaaatcttagaa
atggagggaaagcacaaggaagagtgggacaccttaaaagaagagagagaaaatcttcaa
gtcttggttactcgccaaacatacataatccaggaactggagaaacaattgaacagagcc
accaacaacaatagtgtccttcagaagcagcaactggagctgatggacacagtgcataac
ctcgtcaacctttgcactaaagaagttttactaaagggaggaaaaaaagaggaagagaaa
ccatttagagactgtgcagatgtatatcaagctggttttaataaaagtggaatctacact
atttatattaataatatgccagaacccaaaaaggtattttgcaatatggatgtcaatggg
ggaggttggactgtaatacaacatcgtgaagatggaagtctagatttccaaagaggttgg
aaagaatataaaatgggttttggaaatccctctggtgaatattggctggggaatgagttt
atttttgccattaccagtcagaggcagtacacactaagaattgagttaatggactgtgaa
ggaaaccgagcctattcacaatatgacagattccacataggaaacgaaaagcagaactac
aggttgtatttaaagtgtcacactgggacagcaggaaaacagagcagcctgatcttacat
ggtgctgatttcagcactaaagatgcagataatgacaactgtatgtgcaaatgtgccctc
atgctaacaggaggctggtggtttgatgcttgtggcccatccaatctaaatggaatgttc
tacactgctggacaaaaccatggaaaactgaatgggattaagtggcactacttcaaaggg
cccagttactccttacgttccacaactatgatgattcgacctttggacttttga

DBGET integrated database retrieval system