KEGG   Canis lupus familiaris (dog): 403660
Entry
403660            CDS       T01007                                 

Gene name
IL1RN
Definition
(RefSeq) interleukin-1 receptor antagonist protein precursor
  KO
K05481  interleukin 1 receptor antagonist
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    403660 (IL1RN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    403660 (IL1RN)
   04052 Cytokines and growth factors [BR:cfa04052]
    403660 (IL1RN)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   403660 (IL1RN)
Cytokines and growth factors [BR:cfa04052]
 Cytokines
  Interleukins
   403660 (IL1RN)
SSDB
Motif
Pfam: IL1
Other DBs
NCBI-GeneID: 403660
NCBI-ProteinID: NP_001003096
Ensembl: ENSCAFG00000007277
VGNC: 41962
UniProt: Q9BEH0
Position
17
AA seq 176 aa
METCRCPLSYLISFLLFLSHSETACRPLGKRPCRMQAFRIWDVNQKTFYLRNNQLVAGYL
QGSNTKLEEKLDVVPVEPHAVFLGIHGGKLCLACVKSGDETRLQLEAVNITDLSKNKDQD
KRFTFILSDSGPTTSFESAACPGWFLCTALEADRPVSLTNRPEEAMMVTKFYFQKE
NT seq 531 nt   +upstreamnt  +downstreamnt
atggaaacctgcaggtgtcctctcagctacctaatctctttcctccttttcctgtcccat
tcagagacagcctgccgtcccttggggaagagaccttgcaggatgcaagccttcagaatc
tgggatgttaaccagaagaccttctacctgaggaataaccaactagtcgctggatacttg
caaggatcaaatactaaattagaagagaagttagatgtggtgcccgtcgagcctcatgcc
gtgttcttggggatccatggggggaagctgtgcctggcctgtgtcaagtctggagatgag
accaggctccagctggaggccgttaacatcactgacctgagtaagaacaaggatcaagac
aagcgctttaccttcatcctctcagacagtggccctaccaccagctttgagtctgctgcc
tgccctggctggttcctctgcacagcactggaggccgaccggcctgtcagcctcaccaac
agaccagaagaggccatgatggtcactaagttctacttccagaaggaataa

DBGET integrated database retrieval system