KEGG   Canis familiaris (dog): 403668Help
Entry
403668            CDS       T01007                                 

Gene name
COL6A1
Definition
(RefSeq) collagen alpha-1(VI) chain
  KO
K06238  collagen, type VI, alpha
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04151  PI3K-Akt signaling pathway
cfa04510  Focal adhesion
cfa04512  ECM-receptor interaction
cfa04974  Protein digestion and absorption
cfa05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    403668 (COL6A1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    403668 (COL6A1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    403668 (COL6A1)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    403668 (COL6A1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    403668 (COL6A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    403668 (COL6A1)
   00536 Glycosaminoglycan binding proteins [BR:cfa00536]
    403668 (COL6A1)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   403668 (COL6A1)
Glycosaminoglycan binding proteins [BR:cfa00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   403668 (COL6A1)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   403668 (COL6A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VWA Collagen VWA_2 VWA_3 YcaO
Motif
Other DBs
NCBI-GeneID: 403668
NCBI-ProteinID: XP_003434049
Ensembl: ENSCAFG00000011911
VGNC: 39480
UniProt: F1PFM6
Position
31
AA seq 1026 aa AA seqDB search
MGPGRALLPLLLACWAAAQDAPGSARAVAFQDCPVDLFFVLDTSESVALRLKPYGALVDK
VKAFTKRFIDNLRDRYYRCDRNLVWNAGALHYSDEVEIISPLTPMPADRDALKAKVDAVK
YFGKGTYTDCAIKKGLEELLVGGSHLKENKYLIVVTDGHPLEGYKEPCGGLEDAVNEAKH
LGVKVFSVAITPDHLEPRLSIIATDHTYRRNFTAADWGQSRDAEEIITQTIDTIVDMIKN
NVEQVCCSFECQPARGPPGPRGDPGYEGERGKPGLPGEKGEAGEPGRPGDLGPIGYQGMK
GEKGSRGEKGSRGSKGYKGEKGKRGIDGVDGMKGEMGYPGLPGCKGSPGFDGAQGPPGPK
GDAGAFGRKGEKGAPGADGEPGRPGNTGPPGDEGEPGLPGPPGEKGEAGDEGNPGPDGAP
GERGGPGERGPRGTPGVRGPRGDPGEAGPQGDQGREGPVGIPGDPGEAGPAGPKGYRGDE
GPPGPEGSRGAPGPAGPPGDPGLMGERGEDGPPGNGTEGFPGFPGYPGSRGPPGINGTKG
YPGLKGDEGEAGDPGDDNNDISPPGVKGAKGYRGPEGPQGPPGHTGPPGPDECEILDIIM
KMCSCCECKCGPIDILFVLDSSESIGLQNFEIAKDFVVKVIDRLSRDELVKFEPGQSHVG
VVQYSHNQMQEHVDLRDPNIRSVQELKEAIKKLRWMAGGTFTGEALQYTRNQLLPPTQNN
RIALVITDGRSDTQRDTTPLSVLCGPDIQVVSVGIKDMFGYVAGSDQLNVISCQGLGPQG
RPGISLVKENYAELLEDNFLKNVTTQICIDKKCPDYTCPIMFSSPADITILLDGSASVGS
HNFDTTKRFAKRLAERFLTAGRTDPAHDVRVAVVQYSGPGQQRPGRGALRFLQNYTVLAS
TVDGMDFFNDATDVNDALGYVTRFYREASTRDAKKRLLLFSDGNSQGATAAAIEKAVQEA
QRADIEIFVVVVGRQVNEPHVRVLVTGKTAEYDVAFGERHLFRVPSYQALLRGVFYQTVS
RKVALG
NT seq 3081 nt NT seq  +upstreamnt  +downstreamnt
atggggccgggccgcgctctgctgccgctgctgctcgcctgctgggccgccgctcaggac
gcgccggggagcgcgcgggccgtggccttccaggactgccccgtggacctcttcttcgtg
ctggacacctccgagagcgtggccctgaggctgaagccctatggggccctggtggacaag
gtcaaggcgttcaccaagcgcttcatcgacaacctgagggacaggtactaccggtgtgac
cgcaacttggtgtggaacgcgggcgccctgcactacagcgacgaggtggagatcattagc
ccgctgacgcccatgcccgccgaccgcgacgccctcaaggccaaggtggacgccgtcaag
tacttcggcaagggcacctacacggactgcgccatcaagaaggggctggaggagctgctc
gtggggggctcccacctcaaggagaacaagtacctgatagtggtgacggacgggcacccc
ctggagggctacaaggagccgtgcggcggcctggaggacgccgtgaacgaggccaagcac
ctgggcgtcaaggtcttctccgtggccatcacgcccgaccacctggagccgcgcctgagc
atcatcgccacggaccacacgtaccggcgcaacttcacggcggccgactgggggcagagc
cgggacgccgaggagatcatcacccagaccatcgacaccatcgtggacatgatcaaaaac
aacgtggagcaagtgtgctgctccttcgaatgccagcccgccagaggacctcccgggcca
cggggcgaccccgggtatgagggagaacgtgggaagccgggcctcccaggagagaaagga
gaagccggggagcccggaaggcccggggacctcggacccatcggctaccaggggatgaag
ggagagaaagggagccgaggggagaagggctccagggggtccaagggctacaagggcgag
aagggcaagcgaggcatcgatggtgtggacggcatgaagggggagatgggctaccccggc
ctgccaggctgcaagggctcgcccggattcgacggagctcaaggaccccccgggcccaag
ggtgacgcaggtgccttcggacggaaaggagagaagggtgcccctggagctgatggggag
cccggaaggccggggaacacggggccaccgggagatgagggcgagccggggctgcctggt
ccccccggagagaagggagaagccggcgacgagggaaaccccggaccggacggtgccccc
ggagagaggggcggccctggggaaagaggaccacgggggaccccaggtgtgcggggccca
cggggagacccgggcgaagctggaccccaaggtgaccagggacgagaaggccccgtcggc
atccccggagacccgggcgaggctggccccgctggacctaaaggttaccgaggtgacgag
gggcccccggggcctgagggttccagaggagctcctgggcccgcggggccccccggagac
cccgggctgatgggtgaaaggggcgaagacggccccccgggaaacggcaccgagggcttc
cctggcttccctggctatccgggcagcaggggcccccccgggataaacggcaccaaaggc
tacccaggcctcaagggcgacgagggagaagccggagaccccggagatgacaacaatgac
atctccccaccaggagtcaaaggagcaaaggggtaccggggccccgaaggtccccaggga
cccccaggacacacaggacccccgggaccagatgaatgtgagatcctggacatcatcatg
aaaatgtgctcttgctgtgagtgcaagtgcggccccatcgacatcctcttcgtgctggac
agctccgagagcatcggcctgcagaacttcgagatcgccaaggacttcgttgtcaaggtc
atcgaccggctgagtagggacgagctggtcaagttcgagcctggccagtcgcacgtgggc
gtggtgcagtacagccacaaccagatgcaggagcacgtggacctgagggaccccaacatc
aggagcgtccaggagctcaaggaagccatcaagaagctgcggtggatggcgggcggcacg
ttcacgggcgaggctctgcagtacacgcggaaccagctgctgccgcccacccagaacaac
cgcattgccctggtcatcacggacggccgctcggacacccagagggacaccaccccgctc
agcgtgctctgtggcccggacatccaggtggtctccgtgggcatcaaggacatgtttggc
tacgtcgcgggctctgaccagctcaacgtcatctcctgccaaggcctgggaccccagggc
cggccgggcatctctctggtcaaggagaactatgcggagctgctggaggacaattttctg
aagaacgtcaccacccagatctgtatagacaagaagtgtccagattacacctgcccgatc
atgttctcctccccggccgacatcaccatcctgctggacggctcggccagcgtgggcagc
cacaacttcgacaccaccaagcgcttcgccaagcggctggccgagcgcttcctgacggca
ggcaggacggacccggcgcacgacgtgcgggtggcggtggtgcagtacagcgggcccggg
cagcagcggccgggccgcggggcgctgcggttcctgcagaactacaccgtgctggccagc
accgtggacggcatggacttcttcaacgacgccaccgacgtcaacgatgccctgggctac
gtgacgcgcttctaccgcgaggcctcgacccgcgatgccaagaagaggctgctgctcttc
tccgacggcaactcgcagggcgccacggcggcggccatcgagaaggcggtgcaggaggcc
cagcgcgcggacatcgagatcttcgtggtggtggtgggccgccaggtgaacgagccccat
gtgcgcgtcctggtcaccggcaagacggctgagtacgacgtggccttcggcgagcgccac
ctgttccgcgtgcccagctaccaggccctgctgcgcggcgtcttctaccagacggtgtcc
aggaaggtggcgctgggctag

DBGET integrated database retrieval system