KEGG   Canis lupus familiaris (dog): 403722
Entry
403722            CDS       T01007                                 

Symbol
UBA52
Name
(RefSeq) ubiquitin-60S ribosomal protein L40
  KO
K02927  ubiquitin-large subunit ribosomal protein L40e
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa03010  Ribosome
cfa04120  Ubiquitin mediated proteolysis
cfa04137  Mitophagy - animal
cfa05012  Parkinson disease
cfa05022  Pathways of neurodegeneration - multiple diseases
cfa05167  Kaposi sarcoma-associated herpesvirus infection
cfa05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    403722 (UBA52)
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    403722 (UBA52)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    403722 (UBA52)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    403722 (UBA52)
   05167 Kaposi sarcoma-associated herpesvirus infection
    403722 (UBA52)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    403722 (UBA52)
   05022 Pathways of neurodegeneration - multiple diseases
    403722 (UBA52)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cfa03011]
    403722 (UBA52)
   04121 Ubiquitin system [BR:cfa04121]
    403722 (UBA52)
Ribosome [BR:cfa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    403722 (UBA52)
  Archaea
    403722 (UBA52)
Ubiquitin system [BR:cfa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   403722 (UBA52)
SSDB
Motif
Pfam: ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 Rad60-SLD_2 TBK1_ULD Ubiquitin_5 DUF2407
Other DBs
NCBI-GeneID: 403722
NCBI-ProteinID: NP_001121567
Ensembl: ENSCAFG00000014723
VGNC: 59398
UniProt: P63050
Position
20
AA seq 128 aa
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLHPRAVNCRKKKCGHTNN
LRPKKKVK
NT seq 387 nt   +upstreamnt  +downstreamnt
atgcagatctttgtgaagaccctgacgggcaaaactatcacccttgaggtcgagcccagt
gacaccattgaaaatgtcaaagccaaaatccaagacaaggagggcatcccgcctgaccag
cagcgtctgatttttgcgggcaaacagctagaagatggccgaactctgtcagactacaat
atccagaaagagtccaccttgcacttggtgcttcgcctgcgaggtggcatcattgagcct
tcactccgccagctggcccagaaatacaactgcgacaagatgatctgccgcaagtgttat
gctcgcctgcacccccgtgctgtcaactgccgcaagaagaagtgcggccacaccaacaac
ctgcgccccaaaaagaaggtcaaataa

DBGET integrated database retrieval system