KEGG   Canis familiaris (dog): 403724Help
Entry
403724            CDS       T01007                                 

Gene name
CASP4
Definition
(RefSeq) caspase-1
  KO
K04394  caspase 4 [EC:3.4.22.57 3.4.22.64]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    403724 (CASP4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cfa01002]
    403724 (CASP4)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.57  caspase-4
     403724 (CASP4)
    3.4.22.64  caspase-11
     403724 (CASP4)
Peptidases [BR:cfa01002]
 Cysteine Peptidases
  Family C14: caspase family
   403724 (CASP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 CARD DUF1338
Motif
Other DBs
NCBI-GeneID: 403724
NCBI-ProteinID: NP_001003125
Ensembl: ENSCAFG00000014860
UniProt: Q9MZV7
Position
5
AA seq 404 aa AA seqDB search
MADKVLKDKRRLFVRSVDMGTINGLLDELFEKRVLNHEEMERVRCAHSTVMDQARVLIDS
VLRKGPNACQIFISNICNEDIHLAQTLGLSSGSPSGNDHTKLDSQVEVPSLPAFVENMPG
PTIPDSEESTDTLKLCPPETFVKMYKEKAEEIYPIKERKDRTRLALIICNIEFDHLSTRD
GAELDIAGMESLLEGLGYSVVVKRKLTAKGMESVLREFAARPEHKSSDSTFLVLMSHGIL
NGICGTAHSVENPDVLAYDTIFQIFNNRHCLNLKDKPKVIIIQACRGENPGELWVSDSPK
ASTDSWTHQPLMLQSDAIHKVHVEKDFIAFCSSTPHNVSWRHITKGSLFIAQLITCFQKY
SWCCHLEGVFRKVQQSFEKPDVKAQMPTIERVSMTRYFYLFPGH
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaaggtcctgaaggacaagagaaggctgtttgtccggtcagtagacatgggg
accatcaatggtttgctggatgaactctttgagaaaagagtgctgaaccacgaggagatg
gagcgagtgcggtgtgcacactctacagttatggatcaggcccgagttctgattgactcc
gtccttcggaaagggccaaatgcatgccagatttttatttctaatatttgcaatgaggac
attcacctggcacagacgctggggctctcctcaggttcaccatctggaaatgatcatacc
aaactagactctcaagtagaagttccttctttaccagccttcgtggaaaacatgcctggg
ccaaccattcctgactcagaagaatctacagatactctcaagctttgtcctcctgaaaca
tttgtgaaaatgtataaagagaaggctgaagagatctacccaataaaggagagaaaggat
cgtactcgtctggctctcatcatatgcaatatagagtttgatcatctttctaccagggat
ggagctgaacttgacattgcaggaatggagagtctgctggagggcctgggctacagtgta
gttgtgaaacggaaactcactgctaagggtatggaatcagtgctacgggaatttgctgcc
cgcccagagcataagtcctcagacagcacattcttggtgttaatgtctcacggcatcctg
aatggaatctgtgggaccgcacacagcgtggaaaatccagatgtactagcttatgacacc
atcttccagattttcaacaaccgtcactgcctcaacctcaaggacaaaccgaaggtcatc
atcatccaggcctgcagaggtgaaaatcctggggaactgtgggtcagcgactctccaaaa
gcctcgacagacagctggacacatcaacctctgatgctccagagtgatgccattcacaag
gtccacgtggagaaggacttcattgctttctgctcctcaaccccacataatgtgtcctgg
agacatatcacgaagggatctcttttcattgcacaactcatcacatgcttccaaaaatat
tcctggtgctgtcacctagaaggagtattccggaaggtacaacaatcatttgaaaaacca
gatgtgaaagcccagatgccgaccattgaacgagtatccatgacaagatatttctatctc
ttcccaggacattaa

DBGET integrated database retrieval system