KEGG   Canis lupus familiaris (dog): 403751
Entry
403751            CDS       T01007                                 

Gene name
SLC1A1
Definition
(RefSeq) excitatory amino acid transporter 3
  KO
K05612  solute carrier family 1 (neuronal/epithelial high affinity glutamate transporter), member 1
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04721  Synaptic vesicle cycle
cfa04724  Glutamatergic synapse
cfa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    403751 (SLC1A1)
  09156 Nervous system
   04724 Glutamatergic synapse
    403751 (SLC1A1)
   04721 Synaptic vesicle cycle
    403751 (SLC1A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cfa02000]
    403751 (SLC1A1)
Transporters [BR:cfa02000]
 Solute carrier family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   403751 (SLC1A1)
SSDB
Motif
Pfam: SDF
Other DBs
NCBI-GeneID: 403751
NCBI-ProteinID: NP_001003139
Ensembl: ENSCAFG00000002067
VGNC: 46261
UniProt: Q9N1R4
Position
1
AA seq 524 aa
MGKPARKGCDCRRFLRNNWLLLSTVAAVVLGIAIGVLVREYSKLSSLEKFYFAFPGEILM
RMLKLIILPLIISSMITGVAALDSSVSGKIGLRAVIYYFCTTVIAVVLGIVLVVSIKPGV
SQKVDEIDRTGSSPEVSTVDAMLDLIRNMFPENLVQACFQQYKTKREEVSSPSEPGMNMT
EASVTAIMTTAISKNKTKEYKVVGMYSDGINVLGLIVFCLVFGLVIGKMGEKGQVLVDFF
NALSDATMKIVQIIMCYMPLGILFLIAGKIIEVEDWEIFRKLGLYMATVLSGLAIHSIII
LPLIYFIVVRKNPFRFAMGMAQALLTALMISSSSATLPVTFRCAEEKNQVDKRITRFVLP
VGATINMDGTALYEAVAAVFIAQLDGLDLGIGQIITISVTATAASIGAAGVPQAGLVTMV
IVLSAVGLPPEDVTLIIAVDWLLDRFRTMVNVLGDAFGTGIVEKLSKKELEQMDVSSEVN
IVNPFALESTILDNEDSDTKKSYVNGGFAVDKSDTISFTQTSQF
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgggcaagccggcgaggaagggatgcgactgcaggcgcttcctgaggaacaactggctg
ctgctgtccaccgtggccgccgtggtgctagggattgccataggagtcttggttcgagaa
tacagcaagctgtctagtctggagaaattctactttgcttttcccggtgaaatcctaatg
aggatgctgaaactcatcattttgccattaattatatccagcatgattacaggtgttgct
gcactggattccagtgtatccgggaaaattggtctacgtgctgtcatatattatttctgt
accactgtcattgctgtagttctaggcatcgtgctggtggtgagcatcaagcctggtgtg
tcccagaaagtggatgaaattgacaggacaggcagcagccccgaagtcagtacagtggat
gccatgttagatctgatcaggaatatgttccctgagaatcttgtacaagcctgttttcag
cagtataaaaccaagcgtgaagaagtaagttctcccagtgagccagggatgaacatgacg
gaagcatctgtcaccgctatcatgactactgccatttccaagaacaaaacaaaggaatac
aaagtcgtaggcatgtattcagatggcataaatgtcctgggcctgattgtcttttgcctc
gtctttggacttgtcattggaaaaatgggagaaaaaggacaggttctggtggatttcttc
aatgctctaagtgatgcaaccatgaaaattgttcagatcattatgtgttacatgccactt
ggcattttgttcctgattgctgggaagatcatagaagttgaagactgggaaatattccgc
aagctaggcctttacatggctaccgtcctgagtggcctcgcgatccactccattatcatt
ctcccactgatctacttcatagttgtacggaagaaccctttccgattcgccatgggaatg
gctcaggctctcttgacggctctcatgatctcttccagttcagccacactgcctgtcact
ttccgctgtgcagaagaaaagaaccaagtggacaagaggatcactaggtttgtgctgccc
gtgggagctactatcaacatggacgggactgcactctatgaggctgtggcagctgtgttc
attgcgcagttggatggcctggacttgggcattgggcagatcatcaccatcagtgtcacg
gccacggctgccagcatcggagctgctggtgtgccacaggctggcctggtgaccatggtg
atcgtgctgagtgctgtgggtctgccgccggaggatgtcacgctcatcatcgctgttgac
tggctcctggaccggttcaggaccatggtgaacgtcctcggtgatgcgtttgggacaggc
attgtggagaagctctctaagaaggagctggagcagatggatgtttcatctgaagtcaat
atcgtgaacccgtttgccttggaatccacaatactggataatgaagactcagataccaag
aagtcctatgtcaatggaggcttcgcagtagacaaatctgacactatctcgttcacccag
acctctcagttctag

DBGET integrated database retrieval system