KEGG   Canis familiaris (dog): 403797Help
Entry
403797            CDS       T01007                                 

Gene name
PTGER2
Definition
(RefSeq) prostaglandin E2 receptor EP2 subtype
  KO
K04259  prostaglandin E receptor 2
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04024  cAMP signaling pathway
cfa04080  Neuroactive ligand-receptor interaction
cfa04750  Inflammatory mediator regulation of TRP channels
cfa04924  Renin secretion
cfa05163  Human cytomegalovirus infection
cfa05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    403797 (PTGER2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    403797 (PTGER2)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    403797 (PTGER2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    403797 (PTGER2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    403797 (PTGER2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    403797 (PTGER2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cfa04030]
    403797 (PTGER2)
G protein-coupled receptors [BR:cfa04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    403797 (PTGER2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx DUF412
Motif
Other DBs
NCBI-GeneID: 403797
NCBI-ProteinID: NP_001003170
VGNC: 45143
UniProt: Q9XT82
Position
8
AA seq 361 aa AA seqDB search
MGSISNNSGSEDCESREWLPSGESPAISSAMFSAGVLGNLIALALLARRWRGDAGRRAGR
GNSISLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLMALEPERRACTYFAFAMTFFS
LATMLMLFAMALERYLSIGRPYFYQRHVTRRGGLAVLPTIYTVSLLFCSLPLLGYGQYVQ
YCPGTWCFIRHGRTAYLQLYATLLLLLIVAVLACNFSVILNLIRMHRRSGRSRCGPSLGS
CRDGSGTRRRGERVSVAEETDHLILLAIMTITFAICSLPFTIFAYMNETSSRREKWDLQA
LRFLSINSIIDPWVFAIFRPPVLRLMRSVLCCRVSLRAQDATQTSCSIQSNASRLTFVDT
S
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgggcagtatctccaataactcggggtcggaggactgcgagtctcgggagtggctcccc
tccggcgagagcccggccatcagctccgcgatgttctcggccggggtgctggggaacctc
atcgcgctggcgctgctggcgcgccgctggcggggggacgcgggccgccgcgcaggacgc
gggaactccatctccttgttccacgtgctggtgacagagctggtgttcaccgacctgctc
gggacctgcctcatcagccccgtggtgctggcttcctacgctcggaaccagaccctgatg
gcactggagcctgagaggcgcgcgtgcacctacttcgccttcgccatgaccttcttcagc
ctggccacgatgctcatgctcttcgccatggccctggagcgctacctgtccatcgggcgc
ccctacttctaccagcgccatgtgacgcgccgaggcggcctggccgtgctgcccaccatc
tacacggtctctctgctcttttgctccctgccgctgctgggctacgggcagtacgtccag
tactgccccgggacgtggtgcttcatccggcacggccggaccgcgtacctgcagctgtac
gccaccctgctgctgcttctcatcgtcgcggtgctcgcctgcaacttcagcgtcatcctc
aacctcatccgcatgcaccgtcggagcgggaggagtcgctgcggaccctccttgggcagc
tgccgggacggctctgggacccgcaggagaggggaaagggtgtccgtggcagaggagacg
gaccacctcattctcctggctattatgaccatcaccttcgccatctgctccttgcctttc
acaatttttgcatatatgaatgaaacctcttcacgaagagaaaaatgggacctccaagct
cttagatttttatcgatcaattcaataattgatccttgggtctttgccatctttaggcct
cctgttctgagactaatgcgttcagtcctctgttgtcgggtttcattaagagcacaagat
gcaacacagacttcctgttctatacagtcaaacgccagtagattgacctttgtcgacact
agttag

DBGET integrated database retrieval system