KEGG   Canis familiaris (dog): 403824Help
Entry
403824            CDS       T01007                                 

Gene name
COL1A2
Definition
(RefSeq) collagen alpha-2(I) chain precursor
  KO
K06236  collagen, type I, alpha
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04151  PI3K-Akt signaling pathway
cfa04510  Focal adhesion
cfa04512  ECM-receptor interaction
cfa04611  Platelet activation
cfa04926  Relaxin signaling pathway
cfa04933  AGE-RAGE signaling pathway in diabetic complications
cfa04974  Protein digestion and absorption
cfa05146  Amoebiasis
cfa05165  Human papillomavirus infection
cfa05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    403824 (COL1A2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    403824 (COL1A2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    403824 (COL1A2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    403824 (COL1A2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    403824 (COL1A2)
  09154 Digestive system
   04974 Protein digestion and absorption
    403824 (COL1A2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    403824 (COL1A2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    403824 (COL1A2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    403824 (COL1A2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    403824 (COL1A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cfa00536]
    403824 (COL1A2)
Glycosaminoglycan binding proteins [BR:cfa00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   403824 (COL1A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen COLFI
Motif
Other DBs
NCBI-GeneID: 403824
NCBI-ProteinID: NP_001003187
Ensembl: ENSCAFG00000002069
VGNC: 39465
UniProt: O46392
Position
14
AA seq 1366 aa AA seqDB search
MLSFVDTRTLLLLAVTSCLATCQSLQEATARKGPTGDRGPRGERGPPGPPGRDGDDGIPG
PPGPPGPPGPPGLGGNFAAQYDGKGVGLGPGPMGLMGPRGPPGASGAPGPQGFQGPAGEP
GEPGQTGPAGARGPPGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGIR
GHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSV
GPVGPAGPIGSAGPPGFPGAPGPKGEIGPVGNPGPAGPAGPRGEVGLPGVSGPVGPPGNP
GANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGIVGEPGPAGSKGESGNK
GEPGSAGAQGPPGPSGEEGKRGPNGEAGSAGPSGPPGLRGSPGSRGLPGADGPAGVMGPP
GPRGATGPAGVRGPNGDSGRPGEPGLMGPRGFPGAPGNVGPAGKEGPMGLPGIDGRPGPI
GPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQ
GGKGEQGPAGPPGFQGLPGPAGTAGEVGKPGERGLPGEFGLPGPAGPRGERGPPGESGAA
GPSGPIGSRGPSGPPGPDGNKGEPGVLGAPGTAGASGPGGLPGERGAAGIPGGKGEKGET
GLRGEIGNPGRDGARGAPGAMGAPGPAGATGDRGEAGPAGPAGPAGPRGTPGERGEVGPA
GPNGFAGPAGAAGQPGAKGERGTKGPKGENGPVGPTGPIGSAGPSGPNGPPGPAGSRGDG
GPPGATGFPGAAGRTGPPGPSGITGPPGPPGAAGKEGLRGPRGDQGPVGRTGETGASGPP
GFTGEKGPSGEPGTAGPPGTPGPQGLLGAPGILGLPGSRGERGLPGVAGSVGEPGPLGIA
GPPGARGPPGAVGAPGVNGAPGEAGRDGNPGNDGPPGRDGQAGHKGERGYPGNIGPVGAV
GAPGPHGPVGPTGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGEKGPRGLP
GLKGHNGLQGLPGLAGQHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGQPGTVGPAGIR
GSQGSQGPAGPPGPPGPPGPPGPSGGGYDFGYEGDFYRADQPRSPPSLRPKDYEVDATLK
SLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTG
ETCIRAQPENIPAKNWYRNSKVKKHIWLGETINGGTQFEYNVEGVTTKEMATQLAFMRLL
ANHASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKK
TNEWRKTIIEYKTNKPSRLPILDIAPLDIGDADQEFRVDVGPVCFK
NT seq 4101 nt NT seq  +upstreamnt  +downstreamnt
atgctcagctttgtggatacgcggactttgttgctgcttgcagtaacttcgtgcctagca
acatgccaatctttacaggaggcaactgcaagaaagggcccaactggagatagaggacca
cgtggagaaaggggtccaccaggaccaccaggcagagatggtgacgatggtatcccaggc
cctcctggtccacctggtcctcctggcccccctggtcttggcgggaactttgcagcccag
tatgatggaaaaggagttggccttggccctggaccaatgggtttgatgggacctagaggt
ccacctggtgcatctggcgctcctggccctcaaggtttccaaggacctgctggtgagcct
ggtgaacctggtcaaactggtccagcgggtgctcgtggtccacctgggcctcctggcaag
gctggtgaggatggtcaccctggaaaacctggacgacccggtgagagaggagttgttgga
ccacagggtgctcgtggtttccctgggactcctggacttcctggtttcaagggcattagg
ggacacaatggtctggatggattgaagggacagcccggtgctccaggcgtgaagggtgaa
cctggtgcccctggtgaaaatggaacgccaggtcaaacaggagcccgtgggcttcctggt
gagagaggacgtgttggtgcccctggtccagctggtgcccgtggaagtgatggaagtgtg
ggtcctgtgggtcctgctggtcctatcgggtctgctggccctccaggcttcccaggtgct
cctggccccaagggtgaaatcggacctgttggtaaccccggtcctgctggtcccgcgggt
ccccgtggtgaagtgggtcttccaggtgtttccggccccgttggaccccctggtaaccct
ggagccaacggcctgactggtgctaagggtgctgctggcctgcccggtgtcgctggggct
cctggcctccctggaccccgtgggattcctggtcctgttggtgccgctggtgctactggt
gccagaggaattgttggtgagcctgggccagctggttccaaaggagaaagtggcaacaag
ggtgagcctggctctgctggtgcccaaggtcctcctggtcccagtggtgaagaaggaaag
agaggccccaatggtgaagctggatctgctgggccctctggacctcctgggctgagagga
agtcctggttctcgtggtcttcctggagctgatggcccagctggtgtcatgggtcctccc
ggccctcggggtgccaccggccctgctggtgtccgcggtcccaatggagattctggtcgc
cctggagagcctggcctcatgggaccccgaggttttcctggtgcccctggtaatgttggc
ccagctggtaaagaaggtcccatgggtctccctggtattgatggcaggcctggaccaatt
ggcccagcgggagcaagaggagagcccggcaacatcggattccctggacccaaaggcccc
actggtgatcctggcaaaaatggtgataaaggtcatgctggtcttgctggtgctcggggt
gctccaggtcctgatggaaacaatggtgctcagggacctcctggaccacaaggtgtccaa
ggtggaaaaggtgaacagggtcctgctggtcctccaggcttccagggtctgcctggcccc
gcaggtacagctggtgaagttggcaaaccaggagaaaggggtctccctggtgaatttggt
cttcctggtcctgctggtccaagaggggagcgtggtccccctggagaaagtggtgctgct
ggtccttctggtcctattggaagccgaggtccttctggaccccctgggcccgatggaaac
aagggtgaacctggcgtgcttggcgccccgggcaccgctggcgcgtccggtcccggtgga
ctcccaggagagaggggtgctgccggcattcctggaggcaagggagaaaagggtgaaacc
ggtctcagaggcgaaattggtaacccaggcagagatggcgcccgtggagctcctggtgcc
atgggtgcccctggtcctgccggagccactggtgaccggggtgaagctggtcctgccggt
cccgctggccctgctggtcctcgtggtacccctggtgaacgtggtgaggttggtcccgct
ggccccaatggatttgctggtcctgctggtgctgctggtcaacctggtgctaagggagag
agaggaaccaaagggcccaagggtgaaaatggccccgttggtcccacaggccccattgga
tctgccggcccatctggtccaaatggtccccctggtcctgctggaagtcgtggtgatggt
ggcccccctggtgctactggtttccctggtgctgctgggcggactggtcctcctggaccc
tctggtatcactggccctcctggtccccctggtgctgctggtaaagaaggactccgtggg
cctcgaggtgaccaaggtccagttggccgaacgggagaaacaggtgcctctggtccccct
ggctttactggtgagaagggtccctctggagagcctggtaccgctggacctcctggcaca
ccaggtcctcaaggtctccttggtgctcctggcattctgggtctcccaggctctcggggt
gagcgtggtctaccaggtgttgctggatccgtgggtgaacccggacctcttggcattgct
ggtccacctggggctcgtggtcctcctggagctgtgggtgcgcctggagtcaacggtgct
cctggtgaagctggtcgtgatggcaaccctgggaatgatggtcccccaggccgcgatggt
caagccggacacaagggagagcgtggttaccctggcaacattggtcccgttggcgctgtg
ggtgcacctggtcctcatggccctgtgggtcccactggcaaacacggaaaccgtggtgaa
cctggtcctgctggttctgttggtcccgtcggcgctgttggtccaagaggtcctagtggc
ccacaaggtattcgaggtgataagggagagcctggtgagaaggggcccagaggtcttcct
ggcttaaagggacacaatggactgcaaggtcttcctggtcttgctggtcaacatggcgat
caaggtgcacctggttctgtgggtcctgctggtcctaggggtcctgctggtccttctggc
cctgctggcaaagatggtcgcactgggcaacctggtacagtcggacctgctggcattcgt
ggctctcagggtagccaaggtcctgctggccctcctggtccccctggccctcctggccct
cctggcccaagtggtggtggctatgactttggttatgaaggggacttctacagggctgac
cagcctcgctcaccaccttctctcagacccaaggactatgaagttgatgctactctgaaa
tccctcaacaaccagattgagacccttcttactcctgaaggctctaggaagaacccagct
cgcacatgccgagacctgagactcagccacccagagtggagcagtggttactactggatt
gaccctaaccaaggatgcactatggatgctatcaaagtatactgtgatttctctactggc
gaaacctgcattcgggctcaacctgaaaacatcccagccaagaactggtacagaaactcc
aaggtcaagaagcacatctggttaggagaaactatcaatggtggtacccagtttgaatat
aatgttgaaggagtaaccaccaaggaaatggctactcaactcgccttcatgcgcctgctg
gccaaccatgcctctcaaaacatcacctaccactgcaagaacagcattgcctatatggat
gaggagactggcaacctgaaaaaggctgtcattctgcaaggttccaatgatgttgaactg
gttgccgagggcaacagcaggttcacctacactgttcttgtagacggctgctctaaaaag
acaaatgaatggagaaagacaatcattgaatacaaaacaaataagccatcccgcctgcct
atccttgatattgcacctttggacatcggtgatgctgaccaagaattcagggtggacgtt
ggcccagtctgtttcaaataa

DBGET integrated database retrieval system