KEGG   Canis familiaris (dog): 403838
Entry
403838            CDS       T01007                                 

Gene name
REN
Definition
(RefSeq) renin precursor
  KO
K01380  renin [EC:3.4.23.15]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04614  Renin-angiotensin system
cfa04924  Renin secretion
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    403838 (REN)
   04614 Renin-angiotensin system
    403838 (REN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cfa01002]
    403838 (REN)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.15  renin
     403838 (REN)
Peptidases and inhibitors [BR:cfa01002]
 Aspartic peptidases
  Family A1: pepsin family
   403838 (REN)
SSDB
Motif
Pfam: Asp TAXi_N A1_Propeptide TAXi_C
Other DBs
NCBI-GeneID: 403838
NCBI-ProteinID: NP_001003194
Ensembl: ENSCAFG00000009623
VGNC: 45474
UniProt: Q6DYE7
Position
38
AA seq 403 aa
MARCRMPRWGLLLVLWGSCTFGLPADTGAFRRIFLKKMPSIRESLKERGVDVAGLGAEWN
QFTKRLSSGNSTSPVVLTNYLDTQYYGEIGIGTPPQTFKVVFDTGSANLWVPSTRCSPLY
TACEIHCLYDSSESSSYMENGTTFTIRYGSGKVKGFLSQDMVTVGGITVTQTFGEVTELP
LIPFMLAKFDGVLGMGFPAQAVGGVTPVFDHILSQGVLKEEVFSVYYSRNSHLLGGEVVL
GGSDPQYYQGNFHYVSISKTGSWQIKMKGVSVRSATLVCEEGCMVVVDTGASYISGPTSS
LRLLMDTLGAQELSTNEYVVNCNQVPTLPDISFHLGGRAYTLTSKDYVLQDPYGNEDLCT
LALHGLDVPPPTGPVWVLGASFIRKFYTEFDRHNNRIGFALAR
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggccagatgcagaatgcctcgctggggactcctgctggtgctctggggctcctgcacc
ttcgggctccctgcagacaccggagccttcagacggatcttcctcaagaaaatgccctcc
atccgggaaagcctgaaggagcgaggcgtggatgtggccgggcttggggctgagtggaac
cagttcaccaagagactctcctctggcaacagcacctcccccgtggtcctcaccaactac
ctggatacccagtactacggcgagattggcatcggcaccccaccccagaccttcaaagtc
gtcttcgacacgggctcggccaacctctgggtgccctccaccaggtgcagccctctctac
acagcctgtgagattcactgcctctatgactcctcggaatcctccagctacatggagaac
gggacgacattcaccatccgctacggatctgggaaggtcaaaggcttcctgagccaggac
atggtgactgtgggcggaatcacagtgacacagacgtttggagaggtcacagagctgccc
ctgatacccttcatgctggccaagtttgatggggttctgggcatgggcttccctgcacag
gctgttggtggggtcacccccgtctttgaccacatcctctcccaaggggtgctaaaggag
gaggttttctcagtctactacagcaggaattctcacttgctcggaggagaggtcgtcttg
ggaggcagcgacccccagtattaccaagggaatttccactacgtgagcatcagcaagact
ggttcctggcagatcaaaatgaaaggggtgtctgtgaggtcggccaccttggtctgtgag
gagggctgcatggtagtggtcgataccggtgcatcgtacatctcgggccccaccagctcc
ctgaggctgctcatggacaccctgggggcccaggagctgagcacaaatgagtacgttgtg
aactgtaaccaggtgcctacactccccgacatctccttccacctcggagggagagcctac
acacttaccagcaaggactatgtgttacaggatccctatggtaatgaagacctgtgcacc
ctggccctccacggtctggacgtcccaccgcccactgggcctgtctgggtcctgggcgcc
agcttcatccgcaagttctacacggagtttgatcggcataacaatcgcattggctttgcc
ttggcccgctga

DBGET integrated database retrieval system