KEGG   Canis familiaris (dog): 403850Help
Entry
403850            CDS       T01007                                 

Gene name
CXCL8
Definition
(RefSeq) interleukin-8 precursor
  KO
K10030  interleukin 8
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04060  Cytokine-cytokine receptor interaction
cfa04061  Viral protein interaction with cytokine and cytokine receptor
cfa04062  Chemokine signaling pathway
cfa04064  NF-kappa B signaling pathway
cfa04072  Phospholipase D signaling pathway
cfa04218  Cellular senescence
cfa04620  Toll-like receptor signaling pathway
cfa04621  NOD-like receptor signaling pathway
cfa04622  RIG-I-like receptor signaling pathway
cfa04657  IL-17 signaling pathway
cfa04932  Non-alcoholic fatty liver disease (NAFLD)
cfa04933  AGE-RAGE signaling pathway in diabetic complications
cfa05132  Salmonella infection
cfa05133  Pertussis
cfa05134  Legionellosis
cfa05135  Yersinia infection
cfa05142  Chagas disease (American trypanosomiasis)
cfa05144  Malaria
cfa05146  Amoebiasis
cfa05161  Hepatitis B
cfa05163  Human cytomegalovirus infection
cfa05164  Influenza A
cfa05167  Kaposi sarcoma-associated herpesvirus infection
cfa05200  Pathways in cancer
cfa05202  Transcriptional misregulation in cancer
cfa05219  Bladder cancer
cfa05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    403850 (CXCL8)
   04072 Phospholipase D signaling pathway
    403850 (CXCL8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    403850 (CXCL8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    403850 (CXCL8)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    403850 (CXCL8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    403850 (CXCL8)
   04621 NOD-like receptor signaling pathway
    403850 (CXCL8)
   04622 RIG-I-like receptor signaling pathway
    403850 (CXCL8)
   04657 IL-17 signaling pathway
    403850 (CXCL8)
   04062 Chemokine signaling pathway
    403850 (CXCL8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    403850 (CXCL8)
   05202 Transcriptional misregulation in cancer
    403850 (CXCL8)
  09162 Cancer: specific types
   05219 Bladder cancer
    403850 (CXCL8)
  09163 Immune disease
   05323 Rheumatoid arthritis
    403850 (CXCL8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    403850 (CXCL8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    403850 (CXCL8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    403850 (CXCL8)
   05135 Yersinia infection
    403850 (CXCL8)
   05133 Pertussis
    403850 (CXCL8)
   05134 Legionellosis
    403850 (CXCL8)
  09172 Infectious disease: viral
   05164 Influenza A
    403850 (CXCL8)
   05161 Hepatitis B
    403850 (CXCL8)
   05163 Human cytomegalovirus infection
    403850 (CXCL8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    403850 (CXCL8)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    403850 (CXCL8)
   05144 Malaria
    403850 (CXCL8)
   05142 Chagas disease (American trypanosomiasis)
    403850 (CXCL8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cfa04052]
    403850 (CXCL8)
   00536 Glycosaminoglycan binding proteins [BR:cfa00536]
    403850 (CXCL8)
Cytokines and growth factors [BR:cfa04052]
 Cytokines
  Chemokines
   403850 (CXCL8)
Glycosaminoglycan binding proteins [BR:cfa00536]
 Heparan sulfate / Haparin
  Chemokines
   403850 (CXCL8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 403850
NCBI-ProteinID: NP_001003200
Ensembl: ENSCAFG00000003029
VGNC: 39749
UniProt: P41324
Position
13
AA seq 101 aa AA seqDB search
MTSKLAVALLAAFVLSAALCEAAVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPH
CENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgacttccaagctggctgttgctctcttggcagcttttgtcctttctgcagctctctgt
gaagctgcagttctgtcaagagtcagttcagaacttcgatgccagtgtataaaaacacac
tccacacctttccatcccaaatatattaaagaactgagagtgattgacagtggcccacat
tgtgaaaactcagaaatcattgtaaagcttttcaatggaaatgaggtgtgcctggacccc
aaggaaaaatgggtacaaaaggttgtgcagatatttctaaagaaggctgagaaacaagat
ccgtga

DBGET integrated database retrieval system