KEGG   Canis familiaris (dog): 403856Help
Entry
403856            CDS       T01007                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa01522  Endocrine resistance
cfa04010  MAPK signaling pathway
cfa04015  Rap1 signaling pathway
cfa04068  FoxO signaling pathway
cfa04071  Sphingolipid signaling pathway
cfa04218  Cellular senescence
cfa04261  Adrenergic signaling in cardiomyocytes
cfa04370  VEGF signaling pathway
cfa04380  Osteoclast differentiation
cfa04550  Signaling pathways regulating pluripotency of stem cells
cfa04611  Platelet activation
cfa04620  Toll-like receptor signaling pathway
cfa04621  NOD-like receptor signaling pathway
cfa04622  RIG-I-like receptor signaling pathway
cfa04625  C-type lectin receptor signaling pathway
cfa04657  IL-17 signaling pathway
cfa04658  Th1 and Th2 cell differentiation
cfa04659  Th17 cell differentiation
cfa04660  T cell receptor signaling pathway
cfa04664  Fc epsilon RI signaling pathway
cfa04668  TNF signaling pathway
cfa04670  Leukocyte transendothelial migration
cfa04714  Thermogenesis
cfa04722  Neurotrophin signaling pathway
cfa04723  Retrograde endocannabinoid signaling
cfa04728  Dopaminergic synapse
cfa04750  Inflammatory mediator regulation of TRP channels
cfa04912  GnRH signaling pathway
cfa04914  Progesterone-mediated oocyte maturation
cfa04917  Prolactin signaling pathway
cfa04926  Relaxin signaling pathway
cfa04933  AGE-RAGE signaling pathway in diabetic complications
cfa05014  Amyotrophic lateral sclerosis (ALS)
cfa05132  Salmonella infection
cfa05133  Pertussis
cfa05140  Leishmaniasis
cfa05142  Chagas disease (American trypanosomiasis)
cfa05145  Toxoplasmosis
cfa05152  Tuberculosis
cfa05160  Hepatitis C
cfa05164  Influenza A
cfa05167  Kaposi's sarcoma-associated herpesvirus infection
cfa05169  Epstein-Barr virus infection
cfa05205  Proteoglycans in cancer
cfa05418  Fluid shear stress and atherosclerosis
Module
cfa_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    403856 (MAPK14)
   04010 MAPK signaling pathway
    403856 (MAPK14)
   04370 VEGF signaling pathway
    403856 (MAPK14)
   04668 TNF signaling pathway
    403856 (MAPK14)
   04068 FoxO signaling pathway
    403856 (MAPK14)
   04071 Sphingolipid signaling pathway
    403856 (MAPK14)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    403856 (MAPK14)
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    403856 (MAPK14)
 Organismal Systems
  Immune system
   04611 Platelet activation
    403856 (MAPK14)
   04620 Toll-like receptor signaling pathway
    403856 (MAPK14)
   04621 NOD-like receptor signaling pathway
    403856 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    403856 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    403856 (MAPK14)
   04660 T cell receptor signaling pathway
    403856 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    403856 (MAPK14)
   04659 Th17 cell differentiation
    403856 (MAPK14)
   04657 IL-17 signaling pathway
    403856 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    403856 (MAPK14)
   04670 Leukocyte transendothelial migration
    403856 (MAPK14)
  Endocrine system
   04912 GnRH signaling pathway
    403856 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    403856 (MAPK14)
   04917 Prolactin signaling pathway
    403856 (MAPK14)
   04926 Relaxin signaling pathway
    403856 (MAPK14)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    403856 (MAPK14)
  Nervous system
   04728 Dopaminergic synapse
    403856 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    403856 (MAPK14)
   04722 Neurotrophin signaling pathway
    403856 (MAPK14)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    403856 (MAPK14)
  Development
   04380 Osteoclast differentiation
    403856 (MAPK14)
  Environmental adaptation
   04714 Thermogenesis
    403856 (MAPK14)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    403856 (MAPK14)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    403856 (MAPK14)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    403856 (MAPK14)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    403856 (MAPK14)
  Infectious diseases
   05132 Salmonella infection
    403856 (MAPK14)
   05133 Pertussis
    403856 (MAPK14)
   05152 Tuberculosis
    403856 (MAPK14)
   05164 Influenza A
    403856 (MAPK14)
   05160 Hepatitis C
    403856 (MAPK14)
   05163 Human cytomegalovirus infection
    403856 (MAPK14)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    403856 (MAPK14)
   05169 Epstein-Barr virus infection
    403856 (MAPK14)
   05145 Toxoplasmosis
    403856 (MAPK14)
   05140 Leishmaniasis
    403856 (MAPK14)
   05142 Chagas disease (American trypanosomiasis)
    403856 (MAPK14)
  Drug resistance
   01522 Endocrine resistance
    403856 (MAPK14)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     403856 (MAPK14)
Protein kinases [BR:cfa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   403856 (MAPK14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Haspin_kinase Kinase-like NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 403856
NCBI-ProteinID: NP_001003206
Ensembl: ENSCAFG00000001378
VGNC: 42995
UniProt: O02812
Position
12
AA seq 360 aa AA seqDB search
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGADLLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVVSFVPPPLDQEEMES
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggaaaggcccacgttctaccggcaggagctgaataagacaatctgggaggtg
cccgagcgttaccagaacctgtccccggtgggctccggcgcctacggctccgtgtgtgct
gcttttgacacaaaaactgggttacgtgtggcagtcaagaagctctccagaccatttcag
tccatcattcatgccaaaaggacctacagagaactgcggttactgaaacatatgaaacat
gaaaatgtgattggtctcttggatgtttttacacctgcaaggtctctggaggaattcaat
gatgtgtatctggtgacccatcttatgggagcagatctgaacaacattgtgaaatgtcag
aagcttacggatgaccatgttcagttccttatctaccaaattctccgaggtctcaagtat
atacattcagctgacataattcacagggacctaaaacctagcaatctagctgtgaatgaa
gactgtgagctgaagatcctggactttggactggcccgacatacagatgatgaaatgaca
ggctatgtggctaccaggtggtacagggctcctgagataatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggccgaactgttgactggaaga
acgttgtttcctggtacagaccatattgatcagttgaagctcattttaagactcgttgga
accccaggggctgatcttttgaagaaaatctcctcagagtctgcaagaaactacattcag
tctttgacccagatgccgaagatgaactttgcaaatgtatttattggtgccaatcccttg
gctgtcgacttgctggagaagatgcttgtattggactcagacaagagaattacagcagcc
caagccctcgcacatgcctactttgctcagtaccatgatccagatgatgaaccagtggct
gatccttacgatcagtcctttgaaagcagggacctccttatagatgaatggaaaagcctg
acctacgatgaagtcgtcagctttgtgccgccaccccttgaccaagaagagatggagtcc
tga

DBGET integrated database retrieval system