KEGG   Canis familiaris (dog): 403859Help
Entry
403859            CDS       T01007                                 

Gene name
ADCY5
Definition
(RefSeq) adenylate cyclase type 5
  KO
K08045  adenylate cyclase 5 [EC:4.6.1.1]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00230  Purine metabolism
cfa01100  Metabolic pathways
cfa01522  Endocrine resistance
cfa04015  Rap1 signaling pathway
cfa04022  cGMP-PKG signaling pathway
cfa04024  cAMP signaling pathway
cfa04062  Chemokine signaling pathway
cfa04072  Phospholipase D signaling pathway
cfa04114  Oocyte meiosis
cfa04211  Longevity regulating pathway
cfa04213  Longevity regulating pathway - multiple species
cfa04261  Adrenergic signaling in cardiomyocytes
cfa04270  Vascular smooth muscle contraction
cfa04371  Apelin signaling pathway
cfa04540  Gap junction
cfa04611  Platelet activation
cfa04713  Circadian entrainment
cfa04714  Thermogenesis
cfa04723  Retrograde endocannabinoid signaling
cfa04724  Glutamatergic synapse
cfa04725  Cholinergic synapse
cfa04726  Serotonergic synapse
cfa04727  GABAergic synapse
cfa04728  Dopaminergic synapse
cfa04750  Inflammatory mediator regulation of TRP channels
cfa04911  Insulin secretion
cfa04912  GnRH signaling pathway
cfa04913  Ovarian steroidogenesis
cfa04914  Progesterone-mediated oocyte maturation
cfa04915  Estrogen signaling pathway
cfa04916  Melanogenesis
cfa04918  Thyroid hormone synthesis
cfa04921  Oxytocin signaling pathway
cfa04923  Regulation of lipolysis in adipocytes
cfa04924  Renin secretion
cfa04925  Aldosterone synthesis and secretion
cfa04926  Relaxin signaling pathway
cfa04927  Cortisol synthesis and secretion
cfa04928  Parathyroid hormone synthesis, secretion and action
cfa04934  Cushing syndrome
cfa04935  Growth hormone synthesis, secretion and action
cfa04970  Salivary secretion
cfa04971  Gastric acid secretion
cfa04972  Pancreatic secretion
cfa04976  Bile secretion
cfa05012  Parkinson disease
cfa05030  Cocaine addiction
cfa05031  Amphetamine addiction
cfa05032  Morphine addiction
cfa05034  Alcoholism
cfa05163  Human cytomegalovirus infection
cfa05166  Human T-cell leukemia virus 1 infection
cfa05200  Pathways in cancer
cfa05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    403859 (ADCY5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    403859 (ADCY5)
   04371 Apelin signaling pathway
    403859 (ADCY5)
   04072 Phospholipase D signaling pathway
    403859 (ADCY5)
   04024 cAMP signaling pathway
    403859 (ADCY5)
   04022 cGMP-PKG signaling pathway
    403859 (ADCY5)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    403859 (ADCY5)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    403859 (ADCY5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    403859 (ADCY5)
   04062 Chemokine signaling pathway
    403859 (ADCY5)
  09152 Endocrine system
   04911 Insulin secretion
    403859 (ADCY5)
   04923 Regulation of lipolysis in adipocytes
    403859 (ADCY5)
   04912 GnRH signaling pathway
    403859 (ADCY5)
   04913 Ovarian steroidogenesis
    403859 (ADCY5)
   04915 Estrogen signaling pathway
    403859 (ADCY5)
   04914 Progesterone-mediated oocyte maturation
    403859 (ADCY5)
   04921 Oxytocin signaling pathway
    403859 (ADCY5)
   04926 Relaxin signaling pathway
    403859 (ADCY5)
   04935 Growth hormone synthesis, secretion and action
    403859 (ADCY5)
   04918 Thyroid hormone synthesis
    403859 (ADCY5)
   04928 Parathyroid hormone synthesis, secretion and action
    403859 (ADCY5)
   04916 Melanogenesis
    403859 (ADCY5)
   04924 Renin secretion
    403859 (ADCY5)
   04925 Aldosterone synthesis and secretion
    403859 (ADCY5)
   04927 Cortisol synthesis and secretion
    403859 (ADCY5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    403859 (ADCY5)
   04270 Vascular smooth muscle contraction
    403859 (ADCY5)
  09154 Digestive system
   04970 Salivary secretion
    403859 (ADCY5)
   04971 Gastric acid secretion
    403859 (ADCY5)
   04972 Pancreatic secretion
    403859 (ADCY5)
   04976 Bile secretion
    403859 (ADCY5)
  09156 Nervous system
   04724 Glutamatergic synapse
    403859 (ADCY5)
   04727 GABAergic synapse
    403859 (ADCY5)
   04725 Cholinergic synapse
    403859 (ADCY5)
   04728 Dopaminergic synapse
    403859 (ADCY5)
   04726 Serotonergic synapse
    403859 (ADCY5)
   04723 Retrograde endocannabinoid signaling
    403859 (ADCY5)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    403859 (ADCY5)
  09149 Aging
   04211 Longevity regulating pathway
    403859 (ADCY5)
   04213 Longevity regulating pathway - multiple species
    403859 (ADCY5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    403859 (ADCY5)
   04714 Thermogenesis
    403859 (ADCY5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    403859 (ADCY5)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    403859 (ADCY5)
  09165 Substance dependence
   05030 Cocaine addiction
    403859 (ADCY5)
   05031 Amphetamine addiction
    403859 (ADCY5)
   05032 Morphine addiction
    403859 (ADCY5)
   05034 Alcoholism
    403859 (ADCY5)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    403859 (ADCY5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    403859 (ADCY5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    403859 (ADCY5)
   05163 Human cytomegalovirus infection
    403859 (ADCY5)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    403859 (ADCY5)
Enzymes [BR:cfa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     403859 (ADCY5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA DUF2722 DUF2339
Motif
Other DBs
NCBI-GeneID: 403859
NCBI-ProteinID: NP_001161932
Ensembl: ENSCAFG00000012084
VGNC: 37622
UniProt: P30803
Structure
PDB: 

Position
33
AA seq 1265 aa AA seqDB search
MSGPRSASPPGCAATRGGPEHRAAWGEAEARANGHPHAAGGATRGCSKKPGGAVTPQLQQ
QQQQQQHEQQHEQQQHEQQQHVQQQQRLAKRWRGDDDPPLGGDDPLAGGFGFSFRSRSAW
QERGGDDCGRGSRRRRRGAAGGGSSRAPPAGGGGGPAAAGGAEVRPRSVELGLDERRGRG
RAEPEPEAEAGAPGGDRGARDGDGPAGPGACCRALLQIFRSKKFPSDKLERLYQRYFFRL
NQSSLTMLMAVLVLVCLVMLAFHAARPPLRLPHLAVLAAAVGVILVMAVLCNRAAFHQDH
MGLACYALIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAAVLSGVLL
SALHLAIALRANAQDRFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRECIQA
RLHSQRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEG
FTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCC
VEMGMDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEA
GGKAGRIHITKATLSYLNGDYEVEPGCGGERNAYLKEHSIETFLILRCTQKRKEEKAMIA
KMNRQRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESANPEDEVD
EFLGRAIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASLVFLFICF
VQITIVPHSVFMLSFYLTCFLLLTLVVFVSVIYSCVKLFPGPLQSLSRKIVRSKTNSTLV
GVFTITLVFLSAFVNMFMCNSEDLLGCLADEHNISTSRVNACHVAASAANLSLGDEQGFC
GTPWPSCNFPEYFTYSVLLSLLACSVFLQISCIGKLVLMLAIELIYVLVVEVPRVTLFDN
ADLLVTANAIDFNNNNGTSQCPEHATKVALKVVTPIIISVFVLALYLHAQQVESTARLDF
LWKLQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFAS
IANFSEFYVELEANNEGVECLRVLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLN
DSTYDKVGKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQY
DIWGNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNG
GPPLS
NT seq 3798 nt NT seq  +upstreamnt  +downstreamnt
atgtccgggccccgcagcgcgagccccccgggctgcgcggcgacccgggggggcccggag
caccgcgcggcgtggggggaggcggaggcccgcgccaacggccacccgcacgccgccggg
ggcgcgacccgcggctgcagcaagaagcccgggggggcggtgaccccgcagctgcagcag
cagcagcagcagcagcagcacgagcagcagcacgagcagcagcagcacgagcagcagcag
catgtgcagcagcagcagcgcctggccaagcgctggcgcggcgacgacgaccccccgctg
ggcggcgacgaccccctggccgggggcttcggcttcagcttccgctccaggtcggcctgg
caggagcgcggcggcgacgactgcgggcgcggcagccggcggcggcggcggggcgcggcg
ggcgggggcagctcccgggcgccccctgcgggcggcggcggcggcccggcggcggcgggc
ggggcggaggtgcgcccccgctcggtggagctgggcctggacgagcggcggggccggggc
cgcgccgagcccgagcccgaggccgaggccggcgcccccgggggcgaccgcggggcgcgg
gacggcgacggccccgcagggccgggcgcctgctgccgcgcgctgctgcagatcttccgc
tccaagaagttcccgtcggacaagctggagcggctgtaccagcgctacttcttccgcctg
aaccagagcagcctcaccatgctcatggccgtgctggtgctcgtgtgcctcgtgatgctg
gccttccacgcggcgcggcccccgctgcggctgccccacctggccgtgctggcggccgcg
gtcggggtcatcctggtcatggccgtgctctgcaaccgcgccgccttccaccaggaccac
atgggcctggcctgctacgcgctcatcgccgtggtgctggccgtgcaggtggtgggcctg
ctgctgccccagccgcgcagcgcctccgagggcatctggtggaccgtgttcttcatctac
accatctacacgctgctgcccgtgcgcatgcgggccgccgtcctcagcggagtgctcctg
tcggccctgcacctggccatcgccctgcgcgccaacgcccaggaccggttcctgctcaag
cagctcgtctccaatgtcctcattttctcctgcaccaacatcgtgggtgtctgtacccac
tacccggctgaggtctcccagagacaggccttccaagagacccgggagtgcatccaggca
cggctccactcgcaacgggagaaccagcaacaggagcggctcctgctgtctgtcctgccc
cgacacgttgccatggagatgaaagcagacatcaatgccaagcaggaggatatgatgttc
cataagatttacatccagaaacatgacaacgtgagcatcctgtttgctgacatcgagggc
ttcaccagcttggcatcccagtgcactgcccaggagctggtcatgacgctcaatgagctc
ttcgcccgcttcgacaagctggctgcggagaatcactgtttacgtattaagatcctgggg
gattgttattactgtgtctctgggctgcctgaagcgagggccgaccacgcccactgctgc
gtggagatgggcatggacatgattgaggccatctcgttggtccgggaggtgacaggggtg
aacgtgaacatgcgcgtgggaattcacagcgggcgagtacactgcggtgtccttggtctc
aggaagtggcagttcgacgtctggtctaatgacgtcacgctggccaaccatatggaagct
ggaggcaaggctgggcgcatccacatcaccaaggccacactcagctacctgaacggtgac
tacgaggtggagccaggctgcgggggcgagcgcaacgcctacctcaaggagcacagtatc
gagaccttcctcatcctgcgctgcacccagaagcggaaagaagaaaaggccatgatcgcc
aagatgaatcgccagagaaccaactccattgggcacaacccgccccactggggggccgaa
cgtcccttctacaaccacctaggaggcaaccaggtgtccaaggagatgaagcgcatgggc
ttcgaagaccccaaggacaagaacgcccaggaaagtgcgaaccctgaggatgaagtggat
gaatttctgggccgcgccattgacgccaggagcatcgacaggctgcggtcggagcacgtc
cgcaagttcctcctgaccttcagggagcctgacttagaaaagaagtactccaagcaggtg
gatgaccgattcggtgcctacgtggcatgtgcctcgcttgtcttcctcttcatctgcttt
gtccagatcaccatcgtaccccactccgtgttcatgttgagtttctacttgacctgtttc
ctgctgctgacgttggtggtatttgtgtccgtgatctattcctgcgtgaagctcttcccg
ggcccgctccagagcctctcgaggaagatcgtgcgctccaagaccaacagcaccctggtc
ggggtgttcaccatcaccctggtgttcctgtcggctttcgtcaacatgttcatgtgtaac
tccgaggacctgttgggctgcctggcggacgagcacaacatcagcaccagccgggtcaac
gcgtgccacgtggcggcgtcggcggccaacctcagcctgggcgacgagcagggcttctgc
ggcacgccctggcccagctgcaacttccccgagtacttcacctacagcgtgctgctcagc
ctgctggcctgctccgtgttcctgcagatcagctgcatcgggaagctggtgctcatgctg
gccattgagctcatatacgtgctcgtcgtcgaggtgccccgggtcacactgtttgacaac
gctgacctgctggtcaccgccaacgccatagacttcaacaacaacaacgggacctcgcag
tgccctgagcacgcgaccaaggtggcgctgaaggtggtgacgcccatcatcatctccgtc
ttcgtgctggccctgtacctgcatgcccagcaagtggagtccaccgcccgcctcgacttc
ctctggaaactgcaggccacggaggagaaggaggagatggaggagctgcaggcctacaac
cggcggctgctgcacaacatcctgcccaaggacgtggctgcccacttcctggcccgtgag
cgacgcaacgacgagctctactaccagtcgtgcgagtgcgtggctgtcatgttcgcctcc
atcgccaacttctccgagttctacgtggagcttgaggccaacaatgagggtgtcgagtgc
ctgcgcgtgctcaatgagatcatcgctgactttgatgagatcatcagcgaggatcggttc
aggcagctggagaagatcaagaccattggcagcacctacatggccgcctcaggcctcaat
gactctacatacgacaaggtgggcaagacccacatcaaagccctggctgactttgccatg
aagctcatggaccaaatgaagtacatcaatgagcactccttcaacaacttccagatgaag
atcgggctcaacatcggccccgtggtggccggggtgatcggggctcgcaagcctcagtac
gacatctggggcaatacggtgaatgtggccagccgcatggacagcaccggcgtgccggac
cgcatccaggtcaccacggacatgtaccaggtgttggctgccaacacgtaccagctggag
tgcaggggtgtggtcaaggtcaagggcaaaggcgagatgatgacctacttcctcaacggt
gggcccccgctcagttag

DBGET integrated database retrieval system