KEGG   Canis familiaris (dog): 403873Help
Entry
403873            CDS       T01007                                 

Gene name
GLB1
Definition
(RefSeq) beta-galactosidase precursor
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00052  Galactose metabolism
cfa00511  Other glycan degradation
cfa00531  Glycosaminoglycan degradation
cfa00600  Sphingolipid metabolism
cfa00604  Glycosphingolipid biosynthesis - ganglio series
cfa01100  Metabolic pathways
cfa04142  Lysosome
Module
cfa_M00079  Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    403873 (GLB1)
  Lipid metabolism
   00600 Sphingolipid metabolism
    403873 (GLB1)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    403873 (GLB1)
   00604 Glycosphingolipid biosynthesis - ganglio series
    403873 (GLB1)
   00511 Other glycan degradation
    403873 (GLB1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    403873 (GLB1)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     403873 (GLB1)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   403873 (GLB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5 Cellulase
Motif
Other DBs
NCBI-GeneID: 403873
NCBI-ProteinID: NP_001032730
Ensembl: ENSCAFG00000004652
VGNC: 41249
UniProt: Q9TRY9
Position
23
AA seq 668 aa AA seqDB search
MARPAAVRVLWALLLPLLLGSARGLRNASQRTFTIDYSHNRFLKDGQPFRYISGSIHYSR
VPRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPQPGQYQFSGEQDVEYFIKLAHELGLLVI
LRPGPYICAEWDMGGLPAWLLLKESIILRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGP
IITMQVENEYGSYFTCDYDYLRFLQKLFHHHLGNDVLLFTTDGANEKFLQCGALQGLYAT
VDFGPGANITAAFQIQRKSEPKGPLVNSEFYTGWLDHWGQPHSTVRTEVVASSLHDILAH
GANVNLYMFIGGTNFAYWNGANMPYQAQPTSYDYDAPLSEAGDLTEKYFALREVIRKFEK
VPEGFIPPSTPKFAYGKVALKKLKTVEEALNVLCPPGPINSLYPLTFIQVKQYFGFVMYR
TTLPQDCSDPTPLSSPLSGVHDRAYVSVDGVPQGVMERSNVITLNITGKAGATLDLLVEN
MGRVNYGRYINDFKGLISNLTLGSSILTNWMIFPLNTEDAVRSHLGGWHGPNNGRHDKTF
AHRSSNYTLPAFYMGNFSIPSGIPDLPQDTFIQFPGWTKGQVWINGFNLGRYWPARGPQM
TLFVPRHILVTSTPNTIMVLELEHAPCGDSGPEVCTVEFVDRPVIGAPPTPGHPPPDLSH
RDLRLDYV
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggcccgcggcggttcgcgtgctctgggcgctgctgctgccgctgctgctgggc
tctgcgcgcggcctgcggaatgcttcccagaggacattcacaattgactacagccacaac
cgcttcctgaaggacggccagcccttccgctacatttcgggaagcattcactattcccgc
gtgccccgcttctactggaaggaccggctgctgaagatgaagatggctgggctgaatgcc
atccagacgtacgtgccctggaactttcacgaaccccagccgggacagtaccagttttct
ggggagcaggatgtggaatattttattaagctggcccatgagctgggactgctggtcatc
ctgaggccgggaccctatatctgtgcagagtgggacatgggaggattacctgcttggcta
ttattaaaagaatctattattctccgttcttctgatccagattaccttgcagctgtggac
aaatggttgggagtcctcctgcccaagatgaagcctctcctctatcagaacggagggccg
attataaccatgcaggttgaaaatgaatatggcagctactttacctgcgattatgactac
ctgcgtttcctgcagaagctcttccaccaccacctgggcaatgatgtacttctgttcacc
actgatggggcaaatgaaaagtttctgcagtgcggggctctgcagggcctctatgccaca
gtggactttggaccaggtgccaacatcactgctgctttccaaatccagagaaagagtgag
cccaaaggaccattggtgaattctgaattctataccggctggttggatcattggggccag
ccacactcaacagtgaggactgaagtggtggcttcctccctccatgatatacttgcccat
ggggcaaatgtgaacttgtacatgttcataggtgggaccaattttgcctattggaatggg
gccaacatgccctaccaagcacagcccaccagttacgactatgatgccccactgagcgag
gcaggggacctcactgagaagtattttgctctgcgagaagttattcggaagtttgaaaaa
gtaccagaaggttttatccctccgtctacacccaagtttgcatatggaaaagttgctctg
aagaagttaaagacggtggaggaggccctgaatgttctgtgtccgcctgggcccataaac
agcctttatcccttgacgtttatccaggtgaaacagtatttcggttttgtgatgtaccga
acaacacttcctcaagactgcagtgaccccacacccctgtcttcacccctcagtggagtc
cacgaccgcgcctatgtctctgtggatggggtgccccagggagtcatggagcgaagtaat
gtcatcactctgaacataaccgggaaggctggagccactctggacctgctggtggagaac
atgggacgtgtgaactatggcagatatatcaatgattttaagggccttatttctaacctg
acccttgggtccagtatcctcacaaactggatgatcttcccgttgaacactgaggatgca
gtacgcagccacctgggaggctggcatggccctaacaatggccgccatgataaaaccttt
gcccaccgctcgtctaactacacgctcccggccttttatatggggaacttctctattccc
agtgggatcccagacttgccccaggacacctttatccagtttcctggatggaccaagggt
caggtgtggattaatggctttaacctcggtcgatattggccagcacggggcccccagatg
actttgtttgtgccacggcacatcctggtgacatcaaccccaaacaccatcatggtgctg
gaactggagcacgcgccctgtggtgacagtggcccagaagtgtgcaccgtggagtttgtg
gacaggccggttatcggtgcccctccaacccctggtcatccccctccagacctgtcccat
cgagacttgagactggactatgtctga

DBGET integrated database retrieval system