KEGG   Canis familiaris (dog): 403877Help
Entry
403877            CDS       T01007                                 

Gene name
GPX5
Definition
(RefSeq) epididymal secretory glutathione peroxidase precursor
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00480  Glutathione metabolism
cfa00590  Arachidonic acid metabolism
cfa04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    403877 (GPX5)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    403877 (GPX5)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    403877 (GPX5)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     403877 (GPX5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 403877
NCBI-ProteinID: NP_001003213
Ensembl: ENSCAFG00000011947
VGNC: 41464
UniProt: O46607
Position
35
AA seq 221 aa AA seqDB search
MTAWLGASYVLPILLVSFVQTNAKPEKTKMDCYKDVKGTIYEYEALTLNGNERIQFKQYP
RKHVLFVNVATYCGLTAQYPELNSLQEELKPLGLVVLGFPCNQFGKQGPGENSEILPGLK
YVRPGRGYVPNFQLFEKGDVNGEKEQKVFTFLKLSCPHPSEVLGSFRHISWDPVKVHDIR
WNFEKFLVGPDGVPVLRWFHRTPISTVKEDILVYLKQLKMK
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgactgcatggttaggggcctcctacgttttgcctattctgctagtcagctttgtgcag
acaaatgccaagcctgagaagacaaagatggattgctataaagatgtgaaaggaaccatc
tatgaatatgaagccctcactctcaatggaaatgaacgcattcagttcaagcagtatccg
cgcaagcatgttctttttgtcaatgtggccacctattgtggtctgacagctcagtatcct
gaactgaattcacttcaggaggagctgaagccccttggcctggttgtattgggctttccc
tgcaaccaatttgggaagcagggaccaggagagaactcagagattcttccgggcctgaag
tacgtccggccaggcagaggctatgtccctaacttccagctctttgagaaaggggatgtg
aatggtgaaaaagaacagaaagtcttcaccttcttgaagctctcctgccctcacccctca
gaggttctaggctccttcagacacatctcctgggatcctgtaaaggtccacgatatccgc
tggaactttgagaagttcctggtggggcctgatggggtccctgtcctgcgctggttccac
cggactcccatcagcactgtcaaggaagacatcctggtctacctgaaacagctcaaaatg
aaatag

DBGET integrated database retrieval system