KEGG   Canis familiaris (dog): 403887Help
Entry
403887            CDS       T01007                                 

Gene name
CREM
Definition
(RefSeq) cAMP-responsive element modulator
  KO
K09052  cAMP response element modulator
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    403887 (CREM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cfa03000]
    403887 (CREM)
Transcription factors [BR:cfa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    403887 (CREM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf Rh5 TMCO5
Motif
Other DBs
NCBI-GeneID: 403887
NCBI-ProteinID: NP_001003221
Ensembl: ENSCAFG00000003685
VGNC: 52123
UniProt: P79145
Position
2
AA seq 344 aa AA seqDB search
MTMDTMESQQDGSVTDSVAENESAHMQNQTGQNSIPTLTQVSVAGSGTGRGSPAVTLVQL
PSGQTVHVQGIIQTPQPSVIQSPQIQTVQVATIAETDESAESEGVIDSHKRREILSRRPS
YRKILNELSSDVPGVPKIEEEKSEEEGTPPNIATMAVPTSIYQTSTGQYIAIAQGGTIQI
SNPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGSQVVVQDEETELAP
SHMAAATGDMPTYQIRAPTTALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAA
RECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKAE
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggacacaatggaatctcagcaggatggaagtgtaacagattctgtggcagag
aacgaatctgcacatatgcagaaccagactggtcaaaattcaatccctactttaactcag
gtttctgtagctggatcaggcaccggaagaggctccccagctgtaactctagtacagtta
ccttcgggccaaactgttcatgtccagggaataattcagacaccacagccatcggttatt
cagtcaccacaaatacaaactgttcaggtagcaacaattgcagagacagatgagtctgca
gaatcagaaggtgtaattgattctcataaacgtagagaaatcctttcacgaagaccctct
tatagaaaaatactgaatgaactttcctctgatgtgcctggtgttcccaagattgaagaa
gaaaaatcagaggaagaaggaacgccacctaacatcgctaccatggcagtaccgactagc
atatatcagactagcacggggcaatacattgctatagcccaaggtggaacaatccagatt
tctaacccaggatctgatggtgttcagggactacaggcattaacaatgacaaattcagga
gctcctccaccaggtgctacaattgtacagtatgcagcacaatcagctgatggcacacag
cagttctttgtcccaggcagccaggttgttgttcaagatgaggaaactgaacttgcccca
agtcacatggctgccgccactggtgacatgccaacttaccagatccgagctcctactact
gcattgccacagggagtagtgatggctgcctcgccaggaagtttgcacagtccccagcaa
ctagctgaagaagcaacacgcaaacgagagctgaggctaatgaaaaacagggaagctgcc
cgggagtgtcgcaggaagaagaaagaatatgtcaaatgtcttgaaaatcgtgtggctgtg
cttgaaaaccaaaacaagactctcattgaggaactcaaagccctcaaagatctttattgc
cataaagcagagtaa

DBGET integrated database retrieval system