KEGG   Canis familiaris (dog): 403916Help
Entry
403916            CDS       T01007                                 

Gene name
GALC
Definition
(RefSeq) galactocerebrosidase precursor
  KO
K01202  galactosylceramidase [EC:3.2.1.46]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00600  Sphingolipid metabolism
cfa01100  Metabolic pathways
cfa04142  Lysosome
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    403916 (GALC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    403916 (GALC)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     403916 (GALC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_59 Glyco_hydro_59M DUF1080
Motif
Other DBs
NCBI-GeneID: 403916
NCBI-ProteinID: NP_001003238
Ensembl: ENSCAFG00000017337
VGNC: 41079
UniProt: P54804
Position
8
AA seq 669 aa AA seqDB search
MTAAAGSAGHAAVPLLLCALLVPGGAYVLDDSDGLGREFDGVGAVSGGGATSRLLVNYPE
PYRSQILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYALDENFFRGYEWWLMKE
AKKRNPNIILMGLPWSFPGWIGKGFNWPYVNLQLTAYYIMTWIVGAKHYHDLDIDYIGIW
NERSFDINYIKVLRRMLNYQGLDRVKIIASDNLWEPISASMLLDSELLKVIDVIGAHYPG
THTVKDAKLTKKKLWSSEDFSTLNSDVGAGCLGRILNQNYVNGYMTATIAWNLVASYYEQ
LPYGRCGLMTAQEPWSGHYVVESPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDG
LGNLTIIVETMSHKQSACIRPFLPYFNVSRQFATFVLKGSFSEIPELQVWYTKLGKPSER
YLFKQLDSLWLLDSSSTFTLELQEDEIFTLTTLTVGSKGSYPLPPKSEPFPQIYEDDFDV
DYPFFSEAPNFADQTGVFEYFTNIEDPGEHRFTLRQVLNQRPITWAADAYNTISIIGDYK
WSNLTVRCDVYIETPEKGGVFIAGRVNKGGILIRSARGIFFWIFANGTYRVTGDLAGWVI
YALGRVDVTAKKWYTLTLIIKGRLSSGMLNGKTVWKNIPVSFPKNGWAAIGTHSFEFAQF
DNFHVEATR
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgacggccgccgcgggttcggcgggccacgccgcggtgcccctactgctgtgcgcgctg
ctggtgcccggcggcgcgtacgtgctggacgactccgacgggctgggccgggagttcgac
ggcgtcggggcagtcagcggcggcggggcaacctcccgacttctagtaaattatccagag
ccctatcgttctcaaatattggattatctctttaagccaaactttggtgcctctttgcat
attctaaaagtcgaaataggtggtgatgggcagacaacagatggtactgaaccctcccac
atgcactatgcattagatgagaattttttccgaggatatgagtggtggttaatgaaggaa
gctaagaagcggaaccctaatattatactcatggggttgccatggtcatttcctggatgg
ataggaaaaggtttcaactggccttacgtgaatcttcagctgactgcctactatatcatg
acctggattgtgggtgccaagcattatcatgatttggacattgattatatcgggatttgg
aatgagaggtcatttgacatcaattatatcaaggtgttaagaagaatgctgaactatcaa
ggtcttgatcgagtgaaaatcatagcgagtgacaatctctgggagcccatttctgcttct
atgttgcttgactctgagcttttgaaagtgattgatgttataggagctcattatcctggg
acccatacagtaaaggatgcgaagttgactaagaagaaactttggtcttctgaagatttt
agcactttaaatagtgatgtgggtgcaggctgcttgggccgcatattgaaccagaattat
gtcaatggctacatgactgccacaattgcttggaatttggtggctagttactatgaacag
ttgccttatggacgatgtggattgatgactgctcaggagccatggagtgggcactatgta
gtagagtctcctatctgggtatcagctcataccactcagtttacccaaccaggttggtat
tacctgaagacagttggtcatttagaaaaaggaggaagctacgtggccctgacagatggc
ttaggtaacctcaccatcatcgttgaaactatgagccataaacagtctgcttgtataagg
ccgtttctgccttacttcaacgtgtcacgtcagttcgctacctttgttcttaagggttct
tttagtgaaataccagagctacaggtgtggtatacgaagcttggaaaaccatctgagaga
tatctttttaaacaactggattctctatggctcctcgacagcagcagcactttcaccctg
gagcttcaggaggatgagatcttcacactcaccactctcactgtggggagcaagggtagc
tacccgctgcctcccaagtccgagcctttcccgcaaatttatgaagatgatttcgatgtt
gattacccattttttagtgaagctccgaatttcgctgatcagactggcgtctttgaatac
tttacgaacattgaagaccctggagagcatcgtttcacactgcgccaagttctcaatcag
cggcccattacttgggctgctgatgcatacaataccatcagtattataggagattacaaa
tggtccaatctgactgtaaggtgtgatgtttacatagagactcctgagaagggaggcgtg
ttcattgccggaagagtaaataaaggtggtatcctgattagaagtgccagaggaattttc
ttctggatttttgcaaatggaacctacagagttacaggtgatctagctggatgggtcata
tatgctttaggacgtgttgacgttacagcaaaaaaatggtatacgctcacgttaattatt
aagggccggctgtcctctggcatgctgaacggcaagactgtctggaagaacatccctgtg
agttttccgaagaacggctgggccgccattggaactcactcctttgaatttgcacagttt
gacaactttcatgtggaagccacgagataa

DBGET integrated database retrieval system