KEGG   Canis familiaris (dog): 403963Help
Entry
403963            CDS       T01007                                 

Gene name
HTR1D
Definition
(RefSeq) 5-hydroxytryptamine receptor 1D
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04024  cAMP signaling pathway
cfa04080  Neuroactive ligand-receptor interaction
cfa04726  Serotonergic synapse
cfa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    403963 (HTR1D)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    403963 (HTR1D)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    403963 (HTR1D)
  09157 Sensory system
   04742 Taste transduction
    403963 (HTR1D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cfa04030]
    403963 (HTR1D)
G protein-coupled receptors [BR:cfa04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    403963 (HTR1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 403963
NCBI-ProteinID: NP_001003280
Ensembl: ENSCAFG00000013326
VGNC: 41824
UniProt: P11614
Position
2
AA seq 377 aa AA seqDB search
MSPPNQSLEGLLQEASNRSLNATETPEAWGPETLQALKISLALLLSIITMATALSNAFVL
TTIFLTRKLHTPANYLIGSLAMTDLLVSILVMPISIAYTTTRTWSFGQILCDIWLSSDIT
CCTASILHLCVIALDRYWAITDALEYSKRRTAGRAAVMIATVWVISICISIPPLFWRQAK
AQEDMSDCQVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYVAARNRILNPPSLYGKRFT
TAQLITGSAGSSLCSLSPSLQEERSHAAGPPLFFNHVQVKLAEGVLERKRISAARERKAT
KTLGIILGAFIVCWLPFFVASLVLPICRASCWLHPALFDFFTWLGYLNSLINPIIYTVFN
EEFRQAFQRVVHVRKAS
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtccccgccaaaccagtcactggaaggccttctccaggaggcctccaacagatccctg
aatgctacggaaaccccagaggcctggggtccagagacactccaggccctcaagatctct
ctcgctctgctcctctccatcatcacgatggccacagccctctcgaacgcctttgtgctc
accaccatcttcctcaccaggaagctccacaccccggctaactatctcattggctccctg
gccatgactgacctcttagtgtccatcttggtcatgcccatcagcattgcctataccacc
acccgcacctggagctttggccaaatcctgtgtgacatctggctgtcttctgacatcaca
tgctgcacggcctccatcctgcatctctgtgtcatcgctctggacaggtactgggccatc
accgatgccctggagtatagtaagcgccgcacagcgggccgggcagctgtcatgatcgcc
accgtctgggtcatctccatctgcatctccatccctccgctcttctggcggcaggccaaa
gctcaggaggacatgtcggactgccaggtgaacacatctcagatctcctacaccatctac
tccacgtgcggggccttctacatcccgtccgtgctgctcatcatcctctatggccgcatc
tacgtggctgcccggaaccgcatcctgaatccgccttcgctgtacgggaagcgcttcacc
acagcgcagctcatcacgggctccgcggggtcctcgctctgctccctgagccccagcctc
caagaggagcgctcgcatgcggccggcccccctctctttttcaaccacgtgcaagtcaag
ctggccgagggtgtcctggagcgcaagaggatttcggcggcccgagaaagaaaagccacc
aaaaccctggggatcatcctgggggcctttatcgtctgctggctgcccttctttgttgca
tctctggtcctccccatctgccgggcctcctgctggctccacccagccctctttgacttc
ttcacctggctaggctatctcaactctctcatcaacccaataatatacactgtgtttaac
gaagagtttcggcaagcgtttcagagggttgtccatgtccggaaagcctcctag

DBGET integrated database retrieval system