KEGG   Canis lupus familiaris (dog): 403980
Entry
403980            CDS       T01007                                 

Gene name
CAV1
Definition
(RefSeq) caveolin-1
  KO
K06278  caveolin 1
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04144  Endocytosis
cfa04510  Focal adhesion
cfa05020  Prion disease
cfa05100  Bacterial invasion of epithelial cells
cfa05205  Proteoglycans in cancer
cfa05416  Viral myocarditis
cfa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    403980 (CAV1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    403980 (CAV1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    403980 (CAV1)
  09164 Neurodegenerative disease
   05020 Prion disease
    403980 (CAV1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    403980 (CAV1)
   05416 Viral myocarditis
    403980 (CAV1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    403980 (CAV1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    403980 (CAV1)
Membrane trafficking [BR:cfa04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    403980 (CAV1)
SSDB
Motif
Pfam: Caveolin
Other DBs
NCBI-GeneID: 403980
NCBI-ProteinID: NP_001003296
Ensembl: ENSCAFG00000003404
VGNC: 38751
UniProt: P33724
Position
14
AA seq 178 aa
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMAEEMSEKQVYDAHTKEIDLVNRDPKHLN
DDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFA
ILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPFFEAVGKIFSNIRINMQKET
NT seq 537 nt   +upstreamnt  +downstreamnt
atgtctgggggcaaatacgtagactccgaggggcacctctacaccgttcccatccgggag
cagggcaacatctacaagcccaacaacaaggccatggcggaggagatgagcgagaagcag
gtgtacgacgcgcacaccaaggaaatcgacctggtcaaccgcgaccccaagcatctcaac
gacgacgtggtcaagattgattttgaagatgtgattgcagaaccagaaggaacacacagt
tttgatggcatctggaaggccagcttcaccaccttcactgtgacaaaatactggttttac
cgcttgctgtctgccctctttggcatcccaatggcactcatatggggcatttactttgcc
attctttctttcctgcacatctgggcagttgtgccgtgcattaagagtttcctgattgag
attcagtgcatcagccgtgtctattccatctacgtccacaccttctgtgacccgttcttt
gaggctgttggcaaaatattcagcaatatccgcatcaacatgcagaaagaaacataa

DBGET integrated database retrieval system