KEGG   Canis familiaris (dog): 403983Help
Entry
403983            CDS       T01007                                 

Gene name
KCNMB1
Definition
(RefSeq) calcium-activated potassium channel subunit beta-1
  KO
K04937  potassium large conductance calcium-activated channel subfamily M beta member 1
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04022  cGMP-PKG signaling pathway
cfa04270  Vascular smooth muscle contraction
cfa04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    403983 (KCNMB1)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    403983 (KCNMB1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    403983 (KCNMB1)
Ion channels [BR:cfa04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated
   403983 (KCNMB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CaKB SecIII_SopE_N
Motif
Other DBs
NCBI-GeneID: 403983
NCBI-ProteinID: NP_001003299
Ensembl: ENSCAFG00000016956
VGNC: 42282
UniProt: Q28266
Position
4
AA seq 191 aa AA seqDB search
MGKKLVMAQKRGETRALCLGVAMVMCAVIAYYILGTTMLPLYQKSVWTQKSTCHLIETNI
REQEELEGKKVPQYPCLWVNVSAVGRWAVLYHTEDTRDQNHQCSYIPGSLENYQVARADV
EKVKAKFHEQQIFYCFSTTRENETTVLYRRLYGPQTLLFSLFWPTFLLTGGLLIIAMVKI
NQSLSILAAQR
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagaagctggtgatggcccaaaagcggggagagactcgagccctttgcctgggt
gtggccatggtgatgtgtgctgtcattgcctactatatcctgggcacgaccatgctgccc
ctctaccagaaaagtgtgtggacgcagaaatccacgtgccatctgattgagaccaacatc
agggagcaggaggagctggagggcaagaaggtgccccagtacccgtgcctgtgggtcaac
gtgtcagctgtgggccggtgggctgtgctgtaccacacagaggacactcgggaccagaac
caccagtgctcctatatcccaggcagcctggagaactaccaagttgcccgggccgatgtg
gagaaggtcaaagccaaattccacgagcaacagattttctactgcttctcaacaacccgg
gagaacgagaccactgtcctgtatcggcgcctctatgggccccagaccctcctcttctct
ctcttctggcccaccttcctgctgaccggaggtctcctcatcatcgccatggtcaagata
aaccagtccctttccatcctggcagctcagaggtag

DBGET integrated database retrieval system