KEGG   Canis familiaris (dog): 404005
Entry
404005            CDS       T01007                                 

Gene name
SPCS3
Definition
(RefSeq) signal peptidase complex subunit 3
  KO
K12948  signal peptidase complex subunit 3 [EC:3.4.-.-]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa03060  Protein export
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    404005 (SPCS3)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     404005 (SPCS3)
SSDB
Motif
Pfam: SPC22
Other DBs
NCBI-GeneID: 404005
NCBI-ProteinID: NP_001003314
UniProt: P61008
Position
16
AA seq 180 aa
MNTVLSRANSLFAFSLSVMAALTFGCFITTAFKDRSVPVRLHVSRIMLKNVEDFTGPRER
SDLGFITFDITADLENIFDWNVKQLFLYLSAEYSTKNNALNQVVLWDKIVLRGDNPKLLL
KDMKTKYFFFDDGNGLKGNRNVTLTLSWNVVPNAGILPLVTGSGHVSVPFPDTYEITKSY
NT seq 543 nt   +upstreamnt  +downstreamnt
atgaacacggtgctgtcgcgggcgaactcgctgttcgccttctcgctgagcgtgatggcg
gcgctcacgttcggctgcttcatcaccaccgccttcaaggaccggagcgtcccggtgcgg
ctgcacgtctcgcggatcatgctaaaaaatgtagaagacttcactggacctagagaaaga
agcgatctgggattcatcacgtttgatataacagctgatctagagaatatatttgattgg
aatgttaagcagttgtttctttatttatcagcagaatattcaacaaaaaataatgccctg
aaccaagttgtcctttgggacaagattgttctgcgaggtgataatccaaagctgctgttg
aaagacatgaaaacaaaatattttttctttgacgatggaaatggcctcaagggaaacagg
aacgtcactttaactctatcttggaacgttgtaccaaatgctggaattctacctcttgtg
acaggatcaggtcacgtatctgtcccatttccagatacatatgaaataacgaagagttat
taa

DBGET integrated database retrieval system