KEGG   Canis lupus familiaris (dog): 404019
Entry
404019            CDS       T01007                                 
Symbol
HSP90B1
Name
(RefSeq) endoplasmin precursor
  KO
K09487  heat shock protein 90kDa beta
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04141  Protein processing in endoplasmic reticulum
cfa04151  PI3K-Akt signaling pathway
cfa04657  IL-17 signaling pathway
cfa04915  Estrogen signaling pathway
cfa04918  Thyroid hormone synthesis
cfa05132  Salmonella infection
cfa05200  Pathways in cancer
cfa05207  Chemical carcinogenesis - receptor activation
cfa05215  Prostate cancer
cfa05417  Lipid and atherosclerosis
cfa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    404019 (HSP90B1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    404019 (HSP90B1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    404019 (HSP90B1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    404019 (HSP90B1)
   04918 Thyroid hormone synthesis
    404019 (HSP90B1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    404019 (HSP90B1)
   05207 Chemical carcinogenesis - receptor activation
    404019 (HSP90B1)
  09162 Cancer: specific types
   05215 Prostate cancer
    404019 (HSP90B1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    404019 (HSP90B1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    404019 (HSP90B1)
   05418 Fluid shear stress and atherosclerosis
    404019 (HSP90B1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cfa03110]
    404019 (HSP90B1)
Chaperones and folding catalysts [BR:cfa03110]
 Heat shock proteins
  HSP90
   404019 (HSP90B1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 DUF4518
Other DBs
NCBI-GeneID: 404019
NCBI-ProteinID: NP_001003327
Ensembl: ENSCAFG00000007427
VGNC: 54212
UniProt: P41148
Structure
Position
15:42826278..42843622
AA seq 804 aa
MRALWVLGLCCVLLTFGSVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDG
LNASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISL
TDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTE
AQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNT
LGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTETVEEPMEEEEAAK
EEKEDSDDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEDDEYKAFYK
SFSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITD
DFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADEKY
NDTFWKEFGTNIKLGVIEDHSNRTRLAKLLRFQSSHHPSDITSLDQYVERMKEKQDKIYF
MAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDE
SEKTKESREAIEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMER
IMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIKDMLRRVKEDEDDKTVSDLAVVLFET
ATLRSGYLLPDTKAYGDRIERMLRLSLNIDPDAKVEEEPEEEPEETTEDTTEDTEQDDEE
EMDAGTDDEEQETVKKSTAEKDEL
NT seq 2415 nt   +upstreamnt  +downstreamnt
atgagggccctgtgggtgctgggcctctgctgcgtcctgctgaccttcgggtcagtccga
gctgacgatgaagtcgatgtggatggtacagtggaagaggatctgggtaaaagtagagaa
ggctccaggacagatgatgaagtagtgcagagagaggaagaagctattcagttggatgga
ttaaatgcatcccaaataagagaacttagagaaaaatcagaaaaatttgccttccaagct
gaagtgaatagaatgatgaaacttatcatcaattcattgtataaaaataaagagattttc
ttgagagaactgatttcaaatgcttctgatgccttagataagataaggttaatatcactg
actgatgaaaatgctcttgctggaaatgaggaactaactgtcaaaattaagtgtgacaag
gagaagaatctgctacatgtcacagacactggtgtgggaatgacccgggaagagttggtt
aaaaaccttggtaccatagccaaatctggaacaagcgagtttttaaacaaaatgactgag
gcacaagaggatggccagtcaacttctgaactgattgggcagtttggtgtcggtttctat
tctgccttccttgtcgcagataaggttattgtcacatcaaaacacaacaacgatacccag
catatctgggaatctgactccaatgagttctctgtaattgctgacccacgagggaacacc
ctcggacggggaacaacaattacacttgttttaaaagaagaagcatctgattaccttgaa
ttggacacaattaaaaatctcgtcaagaaatattcacagtttataaacttccctatttat
gtgtggagcagcaagactgaaactgttgaggagcccatggaagaagaagaagcagcaaaa
gaagaaaaagaagattctgatgatgaagctgcagtggaagaagaagaggaggaaaaaaaa
ccaaaaaccaaaaaagttgagaaaactgtctgggattgggagcttatgaatgacatcaaa
ccaatatggcagagaccatcaaaagaagtagaagatgacgaatacaaagctttctacaaa
tcattttcaaaggaaagtgatgaccccatggcttatatccactttactgctgaaggggaa
gtcaccttcaaatcaattttatttgtacctacatctgctccacgtggtctgtttgatgaa
tatggatctaagaagagtgattacattaagctttacgtgcgcagagtattcatcacagat
gacttccatgatatgatgcccaagtaccttaactttgtcaagggtgttgtggactcagat
gatctccccttgaatgtttcccgggaaactcttcagcaacataaactgcttaaggtgatt
agaaagaagcttgtccgtaaaactctggacatgatcaagaagattgctgatgagaagtac
aatgatactttttggaaagaatttggtaccaacatcaagcttggtgtaattgaagaccac
tcaaatcgaacacgtcttgctaaacttcttagattccagtcatctcatcatccaagtgac
ataaccagtctagaccaatacgtggaaagaatgaaggagaagcaagacaaaatctacttc
atggctgggtctagcagaaaagaggctgaatcttctccatttgttgagcgacttctgaaa
aagggctatgaagtgatttatctcaccgaacctgtggacgaatactgcattcaggctctt
cctgagtttgatgggaaaaggttccagaatgttgccaaagaaggtgtgaaatttgatgaa
agtgagaaaacaaaggagagtcgtgaagcgattgagaaagaatttgagcctctgctcaac
tggatgaaagataaagctctcaaggacaagattgaaaaggccgtggtatctcagcgtctg
acagagtctccgtgtgctctggtggccagccagtatggatggtctggcaacatggagaga
atcatgaaagctcaagcataccagacgggcaaagacatctctacaaattactatgccagc
caaaagaaaacatttgaaattaatcccagacatcccctgatcaaagacatgcttcgacga
gttaaggaagatgaagatgacaaaacggtatcggatcttgctgtggttttgtttgagaca
gcaacgctgagatcaggctatctgctaccagacactaaagcatatggagatcgaatagaa
agaatgcttcgcctcagtttaaacattgaccctgatgcaaaggtggaagaagaaccagaa
gaagaacccgaagagacaaccgaggacaccacagaagacacagagcaggacgatgaagaa
gaaatggatgcaggaacagacgacgaagaacaagaaacagtaaagaaatctacagctgaa
aaagatgaattataa

DBGET integrated database retrieval system