KEGG   Canis familiaris (dog): 415128Help
Entry
415128            CDS       T01007                                 

Gene name
CYP2E1
Definition
(RefSeq) cytochrome P450 2E1
  KO
K07415  cytochrome P450 family 2 subfamily E polypeptide 1 [EC:1.14.13.-]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00140  Steroid hormone biosynthesis
cfa00590  Arachidonic acid metabolism
cfa00591  Linoleic acid metabolism
cfa00980  Metabolism of xenobiotics by cytochrome P450
cfa00982  Drug metabolism - cytochrome P450
cfa00983  Drug metabolism - other enzymes
cfa01100  Metabolic pathways
cfa04932  Non-alcoholic fatty liver disease (NAFLD)
cfa05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    415128 (CYP2E1)
   00590 Arachidonic acid metabolism
    415128 (CYP2E1)
   00591 Linoleic acid metabolism
    415128 (CYP2E1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    415128 (CYP2E1)
   00982 Drug metabolism - cytochrome P450
    415128 (CYP2E1)
   00983 Drug metabolism - other enzymes
    415128 (CYP2E1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    415128 (CYP2E1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    415128 (CYP2E1)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.-  
     415128 (CYP2E1)
Cytochrome P450 [BR:cfa00199]
 Cytochrome P450, animal type
  CYP2 family
   415128 (CYP2E1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 415128
NCBI-ProteinID: NP_001003339
Ensembl: ENSCAFG00000013318
VGNC: 50353
UniProt: Q9MZY0
Position
28
AA seq 494 aa AA seqDB search
MAALGITVALLVWMATLMLISIWKQIYSRWKLPPGPFPLPIIGNILQVDIKNVPKSLAKL
AEQYGPVFTLYLGSQRTVVLHGYKAVKEVLLDHKNDLSGRGEVFAFQSHKDRGITFNNGP
GWKDTRRLSLSTLRDYGMGKRGNEERIQREIPFLLEALRGTRGQPFDPTFLLGFAPFNVI
ADILFHKHFDYSDQTGLRIQKLFNENFHLLSTGWLQLYNIFPSYLHYLPGSHRKVLRNVA
ELKDYSLERVKEHQESLDPTCSRDFTDCLLQELQKERYGTEPWYTLDNIAVTVADLFFAG
TETTSTTLRYGLLILMKYPEVEEKLHEEIDRVIGPSRVPAIKDRLEMPYMDAVVHEIQRF
IDLLPSNLPHVANQDTMFRGYVIPKGTVVIPTLDSVLFDKQEFPDPEKFKPEHFLNENGK
FKYSDYFKAFSAGKRVCVGEGLARMELFLFLSAILQHFNLKSLVDPKDIDLSPCTIGFAK
IPPHYKLCVVPRSG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggccgccttgggcatcacagtggccctgctggtgtggatggccaccttaatgcttatc
tctatctggaagcagatctacagccgctggaaactgccccctggcccttttccactgccc
atcattgggaatattctgcaggtggatatcaagaatgttcccaaatctctcgccaagctg
gcagagcagtacgggccagtgttcaccttgtacctgggctcccagcgcacagtggtcctg
catggctacaaggcggtgaaggaagttctgcttgaccacaagaatgacctttctggcaga
ggagaagtcttcgcattccagtcgcacaaggacagagggatcacgttcaacaatgggccc
ggctggaaggacacgcggcgactctccctgagcaccctccgggactacggcatggggaag
cgcggcaacgaggagcggatccagagggagatccccttcctgctggaggcgctcaggggc
acccggggccagcccttcgaccccacctttctcctgggcttcgcccccttcaacgtcatc
gctgacatcctcttccacaagcactttgactactcggatcagactgggctgcggatacag
aagctgttcaacgagaacttccacctgctcagcaccggctggctccagctttataacatt
ttcccaagctatctgcactacctgcccggaagccatagaaaagtcttaagaaatgtggct
gaactaaaggattacagcttagaaagggtgaaggagcaccaggagtcgctggaccccacc
tgctcccgggacttcactgactgcttgctccaggagctgcagaaggagagatacggtacg
gagccttggtataccttggacaacattgccgtgaccgtggctgacctgttctttgcgggc
acggagaccaccagcaccaccctgagatacgggctcctgattctcatgaaatacccagag
gtcgaagagaaacttcatgaagaaatcgacagggtgatcggcccaagccgagtccctgcc
atcaaggacaggctggagatgccctacatggatgccgtggtgcacgagattcagcgattc
atcgacctgctgccctccaacctgccccatgtagcaaaccaggacacgatgttcagagga
tatgtcatccccaagggcacagtggtaattcccacactggactccgtcttgtttgacaaa
caagaattccctgatccagagaagttcaagccagagcactttctgaatgaaaacggaaaa
ttcaaatatagtgactacttcaaggcattctccgcaggaaagcgggtgtgtgttggagaa
ggcctggctcgcatggagctcttcctgttcttgtccgccattttgcagcactttaacctg
aagtctctcgtcgaccccaaggatattgacctcagtccctgcacaatcgggtttgccaag
atccccccccattacaaactctgtgtcgttccccgctcgggctga

DBGET integrated database retrieval system