KEGG   Canis familiaris (dog): 442989Help
Entry
442989            CDS       T01007                                 

Gene name
XIAP
Definition
(RefSeq) E3 ubiquitin-protein ligase XIAP
  KO
K04725  E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa01524  Platinum drug resistance
cfa04064  NF-kappa B signaling pathway
cfa04120  Ubiquitin mediated proteolysis
cfa04210  Apoptosis
cfa04215  Apoptosis - multiple species
cfa04217  Necroptosis
cfa04510  Focal adhesion
cfa04621  NOD-like receptor signaling pathway
cfa05145  Toxoplasmosis
cfa05166  HTLV-I infection
cfa05200  Pathways in cancer
cfa05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    442989 (XIAP)
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    442989 (XIAP)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    442989 (XIAP)
   04215 Apoptosis - multiple species
    442989 (XIAP)
   04217 Necroptosis
    442989 (XIAP)
  Cellular community - eukaryotes
   04510 Focal adhesion
    442989 (XIAP)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    442989 (XIAP)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    442989 (XIAP)
   05222 Small cell lung cancer
    442989 (XIAP)
  Infectious diseases
   05166 HTLV-I infection
    442989 (XIAP)
   05145 Toxoplasmosis
    442989 (XIAP)
  Drug resistance
   01524 Platinum drug resistance
    442989 (XIAP)
Enzymes [BR:cfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     442989 (XIAP)
Ubiquitin system [BR:cfa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    442989 (XIAP)
Mitochondrial biogenesis [BR:cfa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    442989 (XIAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 Chorismate_synt DUF2039
Motif
Other DBs
NCBI-GeneID: 442989
NCBI-ProteinID: NP_001271387
Ensembl: ENSCAFG00000018577
UniProt: Q38IV1
Position
X
AA seq 493 aa AA seqDB search
MTFNSFEGAKTCVPAGINKDEEFVEEFNRLKTFANFPSSSPVSASTLARAGFLYTGEGDT
VRCFSCHASIDRWQYGDSAVGRHRKVSPNCRFINGFYFENTAAQPTNPGIQNGQYNAENY
LRNRDHFVLDRPSETHADYLLRTGQVVDISDTTYPENPAMYSEEARLNSFQNWPDYVHLT
PRELASAGFYYTGIDDQVQCFCCGGKLKNWEPCDNAWSEHRRHFPNCFFVLGRNVNIRSE
SDVASTDRNVPNSTSIPENPAMADYEARIVTFRMWMCSINKEQLARAGFYSLGDGDKVKC
FHCGGGLTDWKPSEDPWEQHAKWFPGCKYLLEEKGQEYINNIHLTHSVLRTAERTRSLTE
RIEDAIFQNPMLQEAIRMGFSFKDIKKIMEEKIQTSGSNYVSLEALVSDLVSAQKDHTQD
ESSQTSLQKEISAEEQLRLLQEEKLCKICMDRNIAVVFIPCGHLVTCKQCAEAVDKCPMC
YTVITFKQKIFMS
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaacagttttgaaggagctaaaacttgtgtacctgcaggcatcaataaggat
gaagaatttgtagaagagtttaatagattaaaaacttttgctaattttccaagtagcagt
cctgtttcagcatcaacgttagcacgagctggttttctgtatactggtgaaggagatact
gtgcggtgctttagttgtcatgcatcaatagatagatggcaatatggagactcagcagtt
ggaagacacaggaaagtatccccaaattgcagatttatcaatggcttttattttgaaaac
actgctgcacaacctacaaatccaggtatccaaaatggtcaatataatgcagaaaactat
ctgagaaacagagatcattttgttttagacagaccatctgagactcatgcagattatctt
ttgagaactggacaggtcgtagatatatcagacaccacatacccggagaaccctgccatg
tatagtgaagaagctagattaaactcatttcagaactggccagactatgtccacttgacc
ccaagagagttagctagtgctggattctactacacaggtattgacgatcaagtgcagtgc
ttttgttgtggtggaaaactgaaaaattgggaaccgtgtgataatgcatggtcagaacac
aggcgacactttcctaattgcttctttgttctgggccggaatgttaatattcgaagtgaa
tctgatgttgcgagtactgataggaacgtcccaaattcaacaagtattccagaaaatcca
gccatggcagattatgaagcacggatcgttacttttcggatgtggatgtgttcaattaac
aaggagcaacttgcaagagctggattttattctttaggggatggtgataaagtaaaatgc
tttcactgtggaggaggactaactgattggaagcccagtgaagacccttgggaacaacat
gctaagtggtttccagggtgtaaatatctgttagaagagaagggacaagaatatataaac
aatattcatttaacccattcagtgctaagaactgctgaaagaacacggtcattaactgaa
agaattgaggatgccatcttccaaaatcctatgttacaagaagctatacgaatgggattc
agtttcaaggacattaagaaaataatggaggaaaaaattcagacatctgggagcaactat
gtatcacttgaggctctggtttcagatctagtgagtgctcagaaagaccatacacaagat
gaatcaagccagacttcattgcaaaaagagattagtgctgaagagcagctcagactcctg
caagaggaaaagctttgcaaaatctgtatggatagaaatattgctgtggttttcattcct
tgcggacatctggtcacttgtaaacaatgtgctgaagcagttgacaaatgtcccatgtgc
tatacagtcattactttcaagcaaaaaatttttatgtcttaa

DBGET integrated database retrieval system