KEGG   Canis familiaris (dog): 448784Help
Entry
448784            CDS       T01007                                 

Gene name
MUC1
Definition
(RefSeq) mucin-1 precursor
  KO
K06568  mucin-1
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    448784 (MUC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    448784 (MUC1)
   04090 CD molecules [BR:cfa04090]
    448784 (MUC1)
Membrane trafficking [BR:cfa04131]
 Others
  Mucins
   Membrane bound mucins
    448784 (MUC1)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   448784 (MUC1)
  Exosomal proteins of breast cancer cells
   448784 (MUC1)
  Exosomal proteins of bladder cancer cells
   448784 (MUC1)
CD molecules [BR:cfa04090]
 Proteins
  448784 (MUC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SEA Stevor
Motif
Other DBs
NCBI-GeneID: 448784
NCBI-ProteinID: NP_001181906
Ensembl: ENSCAFG00000017037
UniProt: F1Q3G6
Position
7
AA seq 537 aa AA seqDB search
MIPSFQAPFFFLLLVTRELTAQGGNSSLTSSPASSSSSTLRKHSSSSLTSSPASSSTTSL
GKLSSSSLTSSPVSGSIITPAQHGTSSPTSSPASSSSSTLRKHSSSSLTSSPAPSSTTSL
GKHSSSSLTSSPVSGSIITPAQHGTSSPTSGPASSSSSTLRKHSSSSLTSSPASSSTSTL
RKHSSSSLTSSPASSSNTSLGKLSSSSPTSRPAPSSTTSLGKHSSSSLTSSPVSGSIITP
AQHGTSSPTSGPASSSSSTLRKHSSSSLTSSPASSSTSTLRKHSSSSSSWASSHTTRTTA
STTNHNMEPPISSNHSTSPQSIRISFFFLSFSILNLQFNSSLENPSSNYYQELQRNISEL
FLQIYGQEYFLGLYNIRFRPGSVVVESTLAFRNGATDANKVKTQFEDSKEGARYNLNISS
ISVRDVSFPSSAPFKSGVPGWGIALLVLVCVLVALAIIYVVALTVCQCRRKNCGQLDIFP
TRDAYHPMSEYPTYHTHGRYVPPGGNRRSPYEEVSAGNGGSSLSYMNPNPAATSANL
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgattccaagcttccaggcccctttcttcttcctgctcctggtaacccgagagcttaca
gcacagggaggcaactcatccctgaccagcagcccagcctcaagctcgtcctccaccttg
agaaagcatagctcctcgtccttgaccagcagcccagcctcaagctcgaccaccagcctg
ggaaaactcagctcctcatccttgaccagcagccctgtctcaggctcgataatcacccca
gcacagcatggcacctcatccccgaccagcagcccagcctcaagctcgtcctccaccttg
agaaagcatagctcctcgtccttgaccagcagcccagccccaagctcgaccaccagcctg
ggaaaacacagctcctcatccttgaccagcagccctgtctcaggctcgataatcacccca
gcacagcatggcacctcatccccgaccagcggcccagcctcaagctcgtcctccaccttg
agaaagcatagctcctcatccttgaccagcagcccagcctcaagctcaacctccaccttg
agaaagcatagctcctcgtccttgaccagcagcccagcctcaagctcaaacaccagcctg
ggaaaactcagctcctcatccccaaccagccgcccagccccaagctcgaccaccagcctg
ggaaaacacagctcctcatccttgaccagcagccctgtctcaggctcgataatcacccca
gcacagcatggcacctcatccccgaccagcggcccagcctcaagctcgtcctccaccttg
agaaagcatagctcctcatccttgaccagcagcccagcctcaagctcaacctccaccttg
agaaagcatagctcctcctcctcatcctgggccagcagccacaccaccaggactaccgcc
agtaccactaaccataacatggaacctcccatctcctccaatcatagcacttctccccag
tctattaggatctccttcttcttcctgtccttttccattttgaacctccagtttaattct
tctctggaaaatcccagcagcaactactaccaggagctgcagaggaacatttctgaattg
tttttgcagatttatggacaggaatatttcctgggcctttataacatcagattcagaccc
ggatctgtggtggtagaatcaactctggccttccgaaatggtgccactgatgccaacaag
gtgaagacacagtttgaagacagcaaagaaggagccagatataacctgaacatctcgagt
attagtgtgcgagatgtgtccttcccttcctctgccccgttcaagtctggggttcctggc
tggggcattgccctgctggtgctggtctgtgttctggttgcactcgccatcatctatgtt
gttgccctgactgtgtgccagtgccgccgaaagaactgtgggcagctggacatctttcca
acccgagacgcctaccatcctatgagcgagtaccccacctaccacacccatgggcgctat
gtgccccctggcggtaatagacgcagcccctatgaggaggtttctgcaggcaatgggggc
agcagcctctcttacatgaacccgaacccagcagccacttctgccaacttgtag

DBGET integrated database retrieval system