KEGG   Canis lupus familiaris (dog): 448786
Entry
448786            CDS       T01007                                 

Gene name
CCL4
Definition
(RefSeq) C-C motif chemokine 4 precursor
  KO
K12964  C-C motif chemokine 4
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04060  Cytokine-cytokine receptor interaction
cfa04061  Viral protein interaction with cytokine and cytokine receptor
cfa04062  Chemokine signaling pathway
cfa04064  NF-kappa B signaling pathway
cfa04620  Toll-like receptor signaling pathway
cfa04623  Cytosolic DNA-sensing pathway
cfa05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    448786 (CCL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    448786 (CCL4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    448786 (CCL4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    448786 (CCL4)
   04623 Cytosolic DNA-sensing pathway
    448786 (CCL4)
   04062 Chemokine signaling pathway
    448786 (CCL4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    448786 (CCL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cfa04052]
    448786 (CCL4)
Cytokines and growth factors [BR:cfa04052]
 Cytokines
  Chemokines
   448786 (CCL4)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 448786
NCBI-ProteinID: NP_001005250
Ensembl: ENSCAFG00000018164
UniProt: Q68AZ0
Position
9
AA seq 92 aa
MKLCVTVLSLLVLVAAFCSPALSAPMGSDPPTACCFSYTLRKIPRNFVADYFETSSLCSQ
PAVVFQTRRGRQVCANPSEPWVQEYMDDLELN
NT seq 279 nt   +upstreamnt  +downstreamnt
atgaagctctgtgtgaccgtcctttctctccttgtgctagtggctgccttctgctccccg
gcgctctcagcaccaatgggttcagatcctcctactgcctgctgcttctcttacaccctg
cggaagattcctcgcaactttgtggcagattactttgagaccagcagcctctgctcccag
ccagctgtggtattccaaaccagaaggggcagacaagtctgtgctaatcccagcgagccc
tgggtccaggaatacatggatgatctggaactgaactga

DBGET integrated database retrieval system