KEGG   Canis familiaris (dog): 474444Help
Entry
474444            CDS       T01007                                 

Gene name
FRS2
Definition
(RefSeq) fibroblast growth factor receptor substrate 2 isoform X1
  KO
K12461  fibroblast growth factor receptor substrate 2
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04714  Thermogenesis
cfa04722  Neurotrophin signaling pathway
cfa05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    474444 (FRS2)
  09159 Environmental adaptation
   04714 Thermogenesis
    474444 (FRS2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    474444 (FRS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRS
Motif
Other DBs
NCBI-GeneID: 474444
NCBI-ProteinID: XP_005625667
Ensembl: ENSCAFG00000000431
VGNC: 40986
UniProt: E2QSI0
Position
10
AA seq 508 aa AA seqDB search
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYL
CLRRYGYDSNLFSFESGRRCQTGQGIFAFKCARAEELFNMLQEIMQNNSINVVEEPVVER
NNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARISNAESNTPKEEPSSIEDRDP
QILLEPEGVKFVLGPTPVQKQLMEKEKLEQLGRDQVSGSGANSTEWDTGYDSDERRDAPS
VNKLVYENINGLSIPSASGVRRGRLTSSSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVF
NFDIRRPSLEHRQLNYIQVDLEGGSDSDNPQTPKTPTTPLPQTPTRRTELYAVIDIERTA
AMSNLQKALPRDDGTSRKTRHNSTDLPM
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgggtagctgttgtagctgtccagataaagacactgtcccagataaccatcggaacaag
tttaaggtcattaatgtggatgatgatgggaatgagttaggttctggcataatggaactt
acagacacagaactgattttatacactcgcaaacgtgactcggtaaaatggcactacctc
tgcctgcgacgctatggctatgattcaaatctcttttcttttgaaagtggccggagatgt
caaactggacaaggaatctttgcctttaagtgtgcccgtgcagaagaattatttaacatg
ttgcaagagattatgcaaaataatagtataaatgtggtggaagagccagttgtagaaagg
aataatcatcagacagaattggaagtccccagaacacctcgaacacctacaactccaggg
tttgctgctcagaatttacctaatggatatccccgatatccctcatttggagatgcttca
tcccatccctcaagcagacatccttctgtgggaagtgcacgcctgccttcagtaggtgaa
gaatctacacatcctttgcttgtagcggaggagcaagtacatacctatgtcaacactaca
ggagtgcaagaagagcggaaaaaccgcacaagtgtgcatgtcccattggaggcgaggatt
tctaatgctgaaagcaacacaccaaaagaagaaccaagtagtattgaggacagggaccct
cagattcttcttgaacccgaaggagtcaaatttgtcttaggaccaacccctgttcaaaag
cagttgatggaaaaagagaaactggagcaacttggaagagaccaagtcagtggaagcggt
gccaatagcacagaatgggacactggatatgacagtgatgagcgaagagatgcaccctct
gttaacaaactggtgtatgaaaatataaatgggttatctatccctagtgcctcaggggtc
aggagaggtcgtctgacatccagcagtacctcagatacccagaatatcaacaactcagct
cagagaagaactgcattattaaactatgaaaatttaccatctttgcctcctgtctgggaa
gcccgcaagcttagtagggatgaagatgacaatttaggaccaaagaccccatctctaaat
ggctaccataataatctagatccaatgcataactatgtaaatacagagaatgtaacagtg
ccggcaagtgctcacaaaatagaatattcgaggcgtcgggactgtacaccgacagtcttt
aactttgatatcagacgcccaagtttagaacacaggcagctcaattacatacaggttgac
ttggaaggtggcagtgactctgacaaccctcagactccaaaaacacctaccactcccctt
ccacagacccctaccaggcgcacagagctgtacgctgtgatagacatcgagagaactgct
gctatgtcaaatctgcagaaagcactgccgcgagacgacggtacgtctaggaagaccaga
cataatagtactgacctgcccatgtga

DBGET integrated database retrieval system